|
|
|
| PUBLIC LOCUS | DESCRIPTION |
| AN11255.4 [Search PubMed] | hypothetical protein |
| AN0708.4 [Search PubMed] | multifunctional aromatic biosynthesis protein (Eurofung); Comment: Clutterbuck: pentafunctional protein gene aromA cloned: PMCID322114 enzyme activities: 3-dehydroquinate synthase EC 4.2.3.4 3-dehydroquinase EC 4.2.1.10 shikimate dehydrogenase EC 1.1.1.25 shikimate kinase EC 2.7.1.71 5-enolpyruvyl shikimate-3-phosphate synthase EC 2.5.1.19 |
| AN0707.4 [Search PubMed] | 5'->3' exoribonculease Dhp1 (AFU_orthologue; AFUA_1G13730) |
| AN0706.4 [Search PubMed] | hypothetical protein similar to UsoAp (Eurofung); Comment: Clutterbuck: usoA: AB097481: relevant to "intracellular protein transport and cellular polarity" |
| AN0705.4 [Search PubMed] | isoleucyl-tRNA synthetase ,cytoplasmic (AFU_orthologue; AFUA_1G13710) |
| AN0704.4 [Search PubMed] | centrin-binding protein Sfi1, putative (AFU_orthologue; AFUA_1G13700) |
| AN0703.4 [Search PubMed] | WD repeat protein (AFU_orthologue; AFUA_1G13690) |
| AN10113.4 [Search PubMed] | conserved hypothetical protein |
| AN10109.4 [Search PubMed] | conserved hypothetical protein |
| AN0701.4 [Search PubMed] | D-isomer specific 2-hydroxyacid dehydrogenase family protein (AFU_orthologue; AFUA_1G13630) |
| AN0700.4 [Search PubMed] | oligopeptide transporter, OPT family, putative (AFU_orthologue; AFUA_1G13620) |
| AN0699.4 [Search PubMed] | cell division protein kinase (Ctk1), putative (AFU_orthologue; AFUA_1G13600) |
| AN0698.4 [Search PubMed] | SH3 domain protein (AFU_orthologue; AFUA_1G13610) |
| AN0697.4 [Search PubMed] | conserved hypothetical protein |
| AN0696.4 [Search PubMed] | M protein repeat protein (AFU_orthologue; AFUA_1G13580) |
| AN0695.4 [Search PubMed] | small nuclear ribonucleoprotein complex protein Nhp2, putative (AFU_orthologue; AFUA_1G13570) |
| AN0694.4 [Search PubMed] | conserved hypothetical protein |
| AN0693.4 [Search PubMed] | conserved hypothetical protein |
| AN0692.4 [Search PubMed] | GTP-binding protein (AFU_orthologue; AFUA_1G13540) |
| AN0691.4 [Search PubMed] | conserved hypothetical protein |
| AN0690.4 [Search PubMed] | SET domain protein (AFU_orthologue; AFUA_1G13520) |
| AN0689.4 [Search PubMed] | facB, Zn(II)2Cys6 transcription factor involved in acetate catabolism (Eurofung); Comment: Flipphi FacB is a zinc binuclear cluster DNA-binding protein that activates the catabolism of acetate in A. nidulans, and in vivo functional binding sites are described in the promoter of the acetamidase amdS gene. emb|AAB63565.1|2262191|acetate regulatory DNA binding protein FacB [Emericella nidulans] emb|U56097.1|2262190|Emericella nidulans acetate regulatory DNA binding protein FacB (facB) gene, complete cds. PMID: 9197408 PMID: 5848711 (isolation of facB mutants) PMID: 3622 (isolation of facB mutants) PMID: 9524126 (in vivo functional binding sites amdS promoter) |
| AN0688.4 [Search PubMed] | transketolase TktA (AFU_orthologue; AFUA_1G13500) |
| AN0687.4 [Search PubMed] | spermidine synthase, putrecine aminopropyltransferase (Eurofung); Comment: PMID 17107606 M Jones Clutterbuck: spdA: AY050641; PMID:12410837 |
| AN0686.4 [Search PubMed] | prohibitin complex subunit Phb1, putative (AFU_orthologue; AFUA_1G13470) |
| AN0685.4 [Search PubMed] | conserved hypothetical protein |
| AN10114.4 [Search PubMed] | conserved hypothetical protein |
| AN0684.4 [Search PubMed] | cell wall proline rich protein, putative (AFU_orthologue; AFUA_1G13450) |
| AN0683.4 [Search PubMed] | conserved hypothetical protein; Comment: Clutterbuck: in intact Mariner-2_AN element (Kapitonov & Jurka 2003 RepBase Reports 3,195 ) co-ordinates 97134-99009 |
| AN11279.4 [Search PubMed] | hypothetical protein |
| AN0682.4 [Search PubMed] | conserved hypothetical protein |
| AN0681.4 [Search PubMed] | transulfuration enzyme family protein, putative (AFU_orthologue; AFUA_5G13810) |
| AN0680.4 [Search PubMed] | Putative Zn(II)2Cys6 transcription factor (Eurofung) |
| AN10108.4 [Search PubMed] | transcriptional regulator, putative (AFU_orthologue; AFUA_5G13800) |
| AN10111.4 [Search PubMed] | activator of the phosphotyrosyl phosphatase activity of PP2A (Eurofung); Comment: Pocsi, Miskei, Karanyi: Orthologue of C.albicans:ORF19.6933, S.cerevisiae:RRD2 involved in response to osmotic stress, product name: Activator of the phosphotyrosyl phosphatase activity of PP2A |
| AN0678.4 [Search PubMed] | hypothetical protein |
| AN0677.4 [Search PubMed] | conserved hypothetical protein |
| AN0676.4 [Search PubMed] | gamma tubulin (Eurofung); Comment: Berl Oakley Structure is correct in the latest annotation (AN0676.3). References: Oakley, C.E. and Oakley, B.R.(1989) Nature 338:662-664; Oakley et al., (1990) Cell 61:1289-1301. |
| AN10110.4 [Search PubMed] | hydantoin racemase (Dcg1), putative (AFU_orthologue; AFUA_1G13380) |
| AN0675.4 [Search PubMed] | aflatoxin B1-aldehyde reductase GliO-like, putative (AFU_orthologue; AFUA_1G13370); Comment: Clutterbuck: 93 nt 3` overlap with Gypsy-3_AN_LTR (Clutterbuck, unpublished ) co-ordinates 76109-76312 |
| AN0674.4 [Search PubMed] | DUF6 domain protein, putative (AFU_orthologue; AFUA_1G13340) |
| AN0673.4 [Search PubMed] | arp2 homolog (Eurofung); Comment: similar to probable actin-like protein ACT2 (GI:28950267) {Neurospora crassa} |
| AN0672.4 [Search PubMed] | 6-phosphogluconate dehydrogenase family protein (AFU_orthologue; AFUA_1G13320) |
| AN0671.4 [Search PubMed] | bZIP transcription factor (Eurofung); Comment: Aspergillus annotation effort (A. Ram) B-zip domains: bZIP_1 101 163 11.6 0.0072 bZIP_2 101 155 6.1 0.14 Related protein sequences Afu1g13310; 0.0; gene model identical; AO090012000550;2e-138; identical; ATEG_00532; 0.0 identical |
| AN0670.4 [Search PubMed] | GTP cyclohydrolase II, putative (AFU_orthologue; AFUA_1G13300); Comment: Clutterbuck: riboB: riboflavin biosynthesis: PMID:16387870 |
| AN0669.4 [Search PubMed] | transposase Tan1-Aspergillus niger (ANG_orthologue; An07g09460); Comment: Clutterbuck: in Mariner-6_AN element (Kapitonov & Jurka 2003 RepBase Reports 3,194 ) co-ordinates 63849-65710 |
| AN0668.4 [Search PubMed] | SAGA complex component (Sgf29), putative (AFU_orthologue; AFUA_1G13290) |
| AN0667.4 [Search PubMed] | mannose-6-phosphate isomerase (Eurofung); Comment: Geysens: high sequence homology to yeast PMI40/YER003C (mannose-6-phosphate isomerase). e-value (after backblastp to yeast database) = 2E-82. Clutterbuck: manA, mannose catabolism cloned: M85239; PMID:1377774 |
| AN0666.4 [Search PubMed] | 6-hexanolactone hydrolase, putative (AFU_orthologue; AFUA_1G13270) |
| AN0665.4 [Search PubMed] | Coatomer subunit epsilon, putative (Eurofung); Comment: Clutterbuck: epsilon-cop: COP1 epsilon subunit; osmosensitivity and cell wall-related: AY885258 |
| AN0664.4 [Search PubMed] | phospholipase C, putative (Eurofung); Comment: Meyer,V: strong similarity to A. fumigatus putative phospholipase C (PMID: 06372009; XP_752695.1; GI:70995880) Clutterbuck: anpc;1 (pclA?), putative phosphoinositide-specific phospholipase C: U65684, GI:1762783, PMID:9163731 |
| AN0663.4 [Search PubMed] | hypothetical protein |
| AN0662.4 [Search PubMed] | adenosine deaminase, putative (AFU_orthologue; AFUA_1G13240) |
| AN0661.4 [Search PubMed] | conserved hypothetical protein |
| AN0660.4 [Search PubMed] | uracil transporter (Eurofung); Comment: Gene product name updated- Ian Paulsen |
| AN0659.4 [Search PubMed] | conserved hypothetical protein |
| AN11278.4 [Search PubMed] | DUF543 domain protein (AFU_orthologue; AFUA_1G13195) |
| AN0658.4 [Search PubMed] | copper-activated transcription factor GRISEA, putative (AFU_orthologue; AFUA_1G13190) |
| AN0657.4 [Search PubMed] | mitochondrial outer membrane protein (Sam35), putative (AFU_orthologue; AFUA_1G13180) |
| AN0656.4 [Search PubMed] | conserved hypothetical protein |
| AN0655.4 [Search PubMed] | cell division control protein 14 (AFU_orthologue; AFUA_1G13170) |
| AN0654.4 [Search PubMed] | hypothetical protein similar to geranylgeranyl diphosphate synthase (Eurofung); Comment: Clutterbuck: ggpS: AF479566 |
| AN0653.4 [Search PubMed] | Smr domain protein (AFU_orthologue; AFUA_1G13150) |
| AN0652.4 [Search PubMed] | conserved hypothetical protein |
| AN0651.4 [Search PubMed] | guanine nucleotide-binding protein alpha subunit (Eurofung); Comment: Takeshita: guanine nucleotide-binding protein alpha subunit FadA (flbA loss-of-function). RF:XP_658255.1: guanine nucleotide-binding protein subunit alpha GB|AAC49476.1|1236941|ENU49917 FadA SP:Q00743: Guanine nucleotide-binding protein alpha subunit. PMID: 8895563, 9305634 Pocsi, Miskei, Karanyi: Orthologue of N.crassa:GNA-1 involved in response to stress, product name: G protein alpha subunit |
| AN0650.4 [Search PubMed] | conserved hypothetical protein |
| AN0649.4 [Search PubMed] | 4-coumarate-CoA ligase, putative (AFU_orthologue; AFUA_1G13110) |
| AN10112.4 [Search PubMed] | Nuclear pore complex protein An-Nup188 (Eurofung); Comment: Identified as a protein with similarity to S. cerevisiae nuclear pore complex protein NUP188. Endogenously tagged protein locates to the NPC during interphase. Disperses from the NPC during mitosis. Essential. .3 gene structure probably wrong. Only 3' end confirmed using 3'RACE. PMID: 16987955 PMID: 15611647 |
| AN5894.4 [Search PubMed] | Pol II transcription elongation factor subunit Cdc73, putative (AFU_orthologue; AFUA_2G11190) |
| AN5893.4 [Search PubMed] | developmental regulator flbA (Eurofung); Comment: Takeshita; Developmental regulator flbA (fluffy low BrlA). Regulator G protein signaling SP:P38093: RF|XP_663497.1|67539446|XM_658405 GB|AAA73955.1|402370|EMEFLBAA PMID: 7830576, 8895563, 9872951 |
| AN11493.4 [Search PubMed] | hypothetical protein |
| AN5892.4 [Search PubMed] | origin recognition complex subunit Orc4, putative (AFU_orthologue; AFUA_2G11170) |
| AN5891.4 [Search PubMed] | PHD finger and SET domain protein, putative (AFU_orthologue; AFUA_2G11210) |
| AN5890.4 [Search PubMed] | proline transporter, putative (Eurofung); Comment: Gene product name updated- Ian Paulsen |
| AN5889.4 [Search PubMed] | WD40 protein related to S. cerevisiae SEH1 (Eurofung); Comment: Steve Osmani. Protein identified related to S. cerevisiae WD40 domain protein Seh1. Non essential. PMID: 16987955 PMID: 15611647 |
| AN5888.4 [Search PubMed] | UDP-N-acetyl-glucosamine-1-P transferase Alg7, putative (AFU_orthologue; AFUA_2G11240); Comment: Geysens: hit obtained after blastp analysis using the yeast ALG&/TUR1/YBR243c gene encoding UDP-N-acetylglucosamine-- dolichyl-phosphate N-acetylglucosaminephosphotransferase. High sequence similarity was confirmed via backblastp against the yeast database (e-value = 7.8E-72 for ALG7). |
| AN5887.4 [Search PubMed] | hypothetical aryl alcohol dehydrogenase (Eurofung); Comment: M Jones SP:Q01752 RF:XP_755458.1: aryl-alcohol dehydrogenase AAD {Aspergillus fumigatus Af293;} (exp=-1; wgp=0; cg=1; genomes=1;) |
| AN5886.4 [Search PubMed] | alpha isopropylmalate isomerase (Eurofung); Comment: Clutterbuck: luA: leucine biosynthesis; alpha isopropylmalate isomerase: cloned: PMID:15517391 |
| AN5885.4 [Search PubMed] | alpha-1,3 glucan synthase (Eurofung); Comment: De Groot: Putative catalytic subunit alpha1,3-glucan synthase complex; SpAgs1-like. R.P. de Vries: function based on sequence similarity. CAZy family GH13. Clutterbuck: PMID:17617716: gene symbol agsA, homologue of A. niger agsD |
| AN11492.4 [Search PubMed] | hypothetical protein |
| AN5884.4 [Search PubMed] | orotate phosphoribosyltransferase (Eurofung); Comment: Clutterbuck: Unique hit for Schizosaccharomyces pombe gi_19112287: orotate phosphoribosyltransferase pyrF: orotidine monophosphate pyrophosphorylase mapped to this region, PMID: 1102932, but mutant now lost. |
| AN5883.4 [Search PubMed] | methylenetetrahydrofolate reductase, methionine biosynthesis (Eurofung); Comment: Clutterbuck: metF, methionine biosynthesis, encoding methylenetetrahydrofolate reductase, cloned: DQ885225, PMID: 17257865 (not to be confused with an earlier "methF", now = metG) |
| AN5882.4 [Search PubMed] | NTP binding protein, putative (AFU_orthologue; AFUA_2G11310) |
| AN5881.4 [Search PubMed] | conserved hypothetical protein |
| AN5880.4 [Search PubMed] | V-type ATPase F subunit, putative (AFU_orthologue; AFUA_2G11330) |
| AN5879.4 [Search PubMed] | ML domain protein, putative (AFU_orthologue; AFUA_2G11340) |
| AN5878.4 [Search PubMed] | peroxisomal 3-ketoacyl-coA thiolase (Kat1), putative (AFU_orthologue; AFUA_2G11350) |
| AN5877.4 [Search PubMed] | bifunctional fatty acid transporter/acyl-CoA synthetase (FAT1), putative (AFU_orthologue; AFUA_2G11360) |
| AN5876.4 [Search PubMed] | autophagy-related protein Atg22B1 (Eurofung); Comment: Kiel: Permease of the major facilitator superfamily GI:40739195 |
| AN10749.4 [Search PubMed] | conserved hypothetical protein |
| AN5875.4 [Search PubMed] | rRNA assembly protein Mis3, putative (AFU_orthologue; AFUA_2G11380) |
| AN10748.4 [Search PubMed] | hypothetical protein |
| AN5874.4 [Search PubMed] | hypothetical protein |
| AN10742.4 [Search PubMed] | hypothetical protein |
| AN5873.4 [Search PubMed] | Gamma-tubulin complex protein 2 (Eurofung) |
| AN5872.4 [Search PubMed] | alpha subunit of the 20S proteasome (Eurofung); Comment: Pocsi, Miskei, Karanyi: Orthologue of C.albicans:PUP2, S.cerevisiae:PUP2 involved in response to stress, product name: Alpha subunit of the 20S proteasome , EC number: 3.4.25.1 |
| AN5871.4 [Search PubMed] | rRNA processing protein Rrp8, putative (AFU_orthologue; AFUA_2G11450) |
| AN5870.4 [Search PubMed] | Putative Zn(II)2Cys6 transcription factor (Eurofung); Comment: Afu orthologue: AFUA_2G11460 |
| AN10752.4 [Search PubMed] | conserved hypothetical protein |
| AN10743.4 [Search PubMed] | BAR domain protein (AFU_orthologue; AFUA_2G11475) |
| AN5868.4 [Search PubMed] | hypothetical protein; Comment: weak similarity to yeast Arv1 involved in sphingolipid metabolism Harrois (5/17/2007) |
| AN5867.4 [Search PubMed] | conserved hypothetical protein: acetylglutamate synthase (Eurofung); Comment: Clutterbuck: ornD: by location and similarity to acetylglutamate synthase: NFIA 9292.m009316, ACLA_070450, Afu1_92.p00296 and ncu07682.3 (arg-14). |
| AN5866.4 [Search PubMed] | acetyltransferase, GNAT family family (AFU_orthologue; AFUA_2G11500) |
| AN5865.4 [Search PubMed] | nucleolar GTP-binding protein (Nog1), putative (AFU_orthologue; AFUA_2G11510) |
| AN5864.4 [Search PubMed] | MFS monosaccharide transporter (Hxt8), putative (AFU_orthologue; AFUA_2G08120) |
| AN5863.4 [Search PubMed] | transposase Tan1-Aspergillus niger (ANG_orthologue; An07g09460); Comment: Clutterbuck: in Mariner-6_AN (Kapitonov & Jurka 2003 RepBase reports 3;214 ) co-ordinates 230891-232757 |
| AN5862.4 [Search PubMed] | ergosterol biosynthesis protein Erg28, putative (AFU_orthologue; AFUA_2G11550) |
| AN5861.4 [Search PubMed] | ketoreductase, putative (AFU_orthologue; AFUA_2G11540) |
| AN5860.4 [Search PubMed] | glucose inducible, low-affinity glucose transporter (MstE) (Eurofung); Comment: MacCabe: i) Aspergillus nidulans mstE gene for putative low affinity glucose transporter MstE, exons 1-4 gi|74035821|emb|AJ812567. ii) putative low affinity glucose transporter MstE [Emericella nidulans] gi|74035822|emb|CAH23705. iii) PMID: 16418173 iv) UniProtKB/TrEMBL entry: Q400D8 Title: Identification of the mstE gene encoding a glucose-inducible, low affinity glucose transporter in Aspergillus nidulans. Journal: J Biol Chem. 2006 Mar 31;281(13):8339-46 Authors: Forment JV, Flipphi M, Ramon D, Ventura L, MacCabe AP. MstE transporter classification: TC 2.A.1.1.36 |
| AN5859.4 [Search PubMed] | Putative Zn(II)2Cys6 transcription factor (Eurofung) |
| AN10751.4 [Search PubMed] | hypothetical protein |
| AN10736.4 [Search PubMed] | hypothetical protein |
| AN5857.4 [Search PubMed] | phospholipid metabolism enzyme regulator, putative (AFU_orthologue; AFUA_2G08080) |
| AN5856.4 [Search PubMed] | CorA family metal ion transporter (Eurofung); Comment: gene product name updated- Ian Paulsen |
| AN5855.4 [Search PubMed] | phosphorylase, putative (AFU_orthologue; AFUA_5G14690) |
| AN5854.4 [Search PubMed] | conserved hypothetical protein |
| AN5853.4 [Search PubMed] | conserved hypothetical protein |
| AN5852.4 [Search PubMed] | conserved hypothetical protein |
| AN10735.4 [Search PubMed] | hypothetical protein |
| AN10750.4 [Search PubMed] | involucrin repeat protein (AFU_orthologue; AFUA_2G08060) |
| AN5850.4 [Search PubMed] | short chain dehydrogenase/reductase family protein (AFU_orthologue; AFUA_2G08050) |
| AN5849.4 [Search PubMed] | Putative Zn(II)2Cys6 transcription factor (Eurofung); Comment: Afu orthologue: AFUA_2G08040 |
| AN5848.4 [Search PubMed] | conserved hypothetical protein |
| AN5847.4 [Search PubMed] | conserved hypothetical protein |
| AN5846.4 [Search PubMed] | FAD binding oxidoreductase, putative (AFU_orthologue; AFUA_4G14630) |
| AN5845.4 [Search PubMed] | RING-finger domain protein, putative (AFU_orthologue; AFUA_5G14845) |
| AN5844.4 [Search PubMed] | hypothetical protein |
| AN5843.4 [Search PubMed] | phosphoenolpyruvate synthase, putative (AFU_orthologue; AFUA_5G14790) |
| AN5842.4 [Search PubMed] | hypothetical protein similar to L-lactate dehydrogenase (Eurofung); Comment: Flipphi ATTENTION: CURRENT GENE MODEL WRONG hypothetical protein similar (Expect = 5e-46; Identities 44%, Positives 63%) to functional Rhizopus arrhizus NAD(+)-dependent L-lactate dehydrogenases A and B (LDH): emb|AAF74436|8308018|lactate dehydrogenase A [Rhizopus arrhizus] sp|Q9P4B6|17369362|LDHA_RHIOR L-lactate dehydrogenase A (L-LDH A) emb|AF226154|8308017|Rhizopus arrhizus lactate dehydrogenase (ldhA) gene, complete cds. NB. Converts pyruvate to lactate. emb|AAF61914|7407106|lactate dehydrogenase B [Rhizopus arrhizus] sp|Q9P4B5|17369359|LDHB_RHIOR L-lactate dehydrogenase B (L-LDH B) emb|AF226155|7407105|Rhizopus arrhizus lactate dehydrogenase (ldhB) gene, complete cds. NB. Converts L-lactate to pyruvate. PMID: 10831409 |
| AN5841.4 [Search PubMed] | nucleoside-diphosphate-sugar epimerase, putative (AFU_orthologue; AFUA_8G07320) |
| AN10740.4 [Search PubMed] | 60S ribosomal protein L19 (AFU_orthologue; AFUA_2G07970) |
| AN10734.4 [Search PubMed] | translational activator, putative (AFU_orthologue; AFUA_2G07960) |
| AN5839.4 [Search PubMed] | ATP dependent RNA helicase, putative (AFU_orthologue; AFUA_2G07950) |
| AN5838.4 [Search PubMed] | NADPH--cytochrome P450 reductase, hypothetical protein (Eurofung); Comment: RF:XP_750985.1: NADPH cytochrome P450 reductase CprA {Aspergillus fumigatus Af293;} (exp=-1; wgp=0; cg=1; genomes=1; )^|^RF|XP_750985.1|70992273|XM_745892 NADPH cytochrome P450 reductase CprA {Aspergillus fumigatus Af293;} (exp=-1; wgp=0; cg=1; genomes=0; )^|^GB|EAL88947.1|66848618|CM000174 NADPH cytochrome P450 reductase (CprA), putative {Aspergillus fumigatus Af293;} (exp=-1; wgp=0; cg=1; genomes=1; ) M Jones |
| AN5837.4 [Search PubMed] | cytochrome P450, putative (Eurofung); Comment: Krasevec & Kelly: ok |
| AN5836.4 [Search PubMed] | cell pattern formation-associated APSES transcription factor stuA (Eurofung); Comment: Takeshita; Cell pattern formation-associated protein stuA.transcription factor SP:P36011: GB|AAA33325.2|33465815| RF:XP_663440.1: PMID: 2062309, 1516832, 9312029 |
| AN11491.4 [Search PubMed] | hypothetical protein |
| AN10747.4 [Search PubMed] | Patatin-like serine hydrolase, putative (AFU_orthologue; AFUA_2G07870) |
| AN10746.4 [Search PubMed] | MOSC domain protein (AFU_orthologue; AFUA_2G07820) |
| AN10745.4 [Search PubMed] | serine hydroxymethyltransferase (Eurofung); Comment: M Jones SP:Q7S5N8: Putative serine hydroxymethyltransferase, mitochondrial precursor(EC 2.1.2.1) (Serine methylase) (Glycine hydroxymethyltransferase)(SHMT). {Neurospora crassa;} (exp=-1; wgp=-1; cg=-1; genomes=-1; ) S. cerevisiae mitochondrial Shm1p similarity M Jones |
| AN10744.4 [Search PubMed] | hypothetical protein |
| AN5834.4 [Search PubMed] | GPI anchored protein, putative (AFU_orthologue; AFUA_2G07800); Comment: Piet de Groot: GPI-anchored protein according to BIG-PI Fungal Predictor |
| AN5833.4 [Search PubMed] | propionate-CoA ligase (Eurofung); Comment: Flipphi related to acetyl coenzyme A synthetase. Clutterbuck: PMID 15514053 (gene symbol, EC# and product name) |
| AN5832.4 [Search PubMed] | Ras small monomeric GTPase RasB (AFU_orthologue; AFUA_2G07770); Comment: Clutterbuck: rasB: Ras signal transduction homologue involved in conidiation and conidial germination: PMID:14732259 |
| AN5831.4 [Search PubMed] | glutathione S-transferase (Eurofung); Comment: Pocsi, Miskei, Karanyi: Orthologue of S.pombe:Gst3 involved in response to stress, product name: Glutathione S-transferase , EC number: 2.5.1.18 |
| AN5830.4 [Search PubMed] | haloacid dehalogenase, type II (AFU_orthologue; AFUA_2G07750) |
| AN5829.4 [Search PubMed] | nuclear migration protein, putative (AFU_orthologue; AFUA_2G07730) |
| AN5828.4 [Search PubMed] | cytochrome b5, putative (AFU_orthologue; AFUA_2G07720) |
| AN5827.4 [Search PubMed] | mRNA splicing factor RNA helicase (Cdc28), putative (AFU_orthologue; AFUA_2G07710) |
| AN10733.4 [Search PubMed] | RNA binding protein, putative (AFU_orthologue; AFUA_2G07650) |
| AN10741.4 [Search PubMed] | cyclin-dependent protein kinase complex component, putative (AFU_orthologue; AFUA_2G07660) |
| AN5824.4 [Search PubMed] | palmitoyltransferase SidR (AFU_orthologue; AFUA_2G07670) |
| AN5823.4 [Search PubMed] | ornithine monooxygenase (Eurofung); Comment: Clutterbuck: sidA; sierophore biosynthesis, ornithine monooxygenase AY223811; PMID:12828635 Pocsi, Miskei, Karanyi: Ornithine monooxygenase SidA, involved in response to oxidative stress, product name: Ornithine monooxygenase |
| AN5822.4 [Search PubMed] | hypothetical protein similar to AnkA (Eurofung); Comment: Clutterbuck: gene symbols ankA (and sntA): kinase A, suppressor of nimT: U25693; PMID:9009279, 11606533, Pocsi, Miskei, Karanyi: Orthologue of S.pombe:Wee1 involved in DNA damage checkpoint, G2/M transition DNA damage checkpoint, product name: Dual specificity protein kinase , EC number: 2.7.11.1 |
| AN5821.4 [Search PubMed] | Vacuolar Ca(2+)/H(+) exchanger, putative (Eurofung); Comment: Gene product name updated- Ian Paulsen Specht: Vacuolar calcium ion transporter (Vacuolar Ca(2+)/H(+) exchanger, putative) by homology to S.cerevisiae Vcx1p |
| AN5820.4 [Search PubMed] | cystathionine beta-synthase (CBS) (Eurofung); Comment: Clutterbuck: mecA: cystathionine beta-synthase mapped to this area: PMID:4593999 |
| AN5819.4 [Search PubMed] | SRP receptor beta subunit (Srp102), putative (AFU_orthologue; AFUA_2G07600); Comment: Archer: possible SRP102 orthologue for docking of secretory proteins into the ER. |
| AN5818.4 [Search PubMed] | beta-1,6-glucan boisynthesis protein (Knh1), putative (AFU_orthologue; AFUA_2G07590) |
| AN5817.4 [Search PubMed] | glutamate 5-kinase (Eurofung); Comment: Flipphi/Clutterbuck: ATP:L-glutamate 5-phosphotransferase, necessary for the biosynthesis of L-proline and L-arginine. hypothetical protein similar (Expect = 2e-86; Identities 54%, Positives 69%) to S. cerevisiae Pro1p gi|1709785|sp|P32264|PROB_YEAST Glutamate 5-kinase (Gamma-glutamyl kinase) (GK) PMID: 5980118 (A. nidulans proB mutants) PMID: 13520441 (mapping of proB mutations) PMID: 1350780 (S. cerevisae PRO1 gene) |
| AN5816.4 [Search PubMed] | Ku70-binding protein, putative (AFU_orthologue; AFUA_2G07560) |
| AN5815.4 [Search PubMed] | Putative aurora kinase (Eurofung); Comment: Berl Oakley: Identified as a putative aurora kinase by Dr. C. Zheng and Dr. B. Liu. Updated January 29, 2007. |
| AN5814.4 [Search PubMed] | JipA protein, TIP41-like family, TOR signalling pathway (Eurofung); Comment: M Jones Cho JH, Yun SS, Jang YK, Cha MJ, Kwon NJ and Chae SK (2003) Identifiaction and cloning of jipA encoding a polypeptide that interacts with a homolog of Rad6, UVSJ in Aspergillus nidulans Journal of Microbiology 41 (1) 46-51 GB:AAO47348.1: JIPA {Emericella nidulans;} (exp=-1; wgp=0; cg=-1; genomes=0; ) GB:CAG30552.1: TipA protein {Emericella nidulans;} (exp=-1; wgp=0; cg=-1; genomes=0; ) |
| AN5813.4 [Search PubMed] | conserved hypothetical protein |
| AN5812.4 [Search PubMed] | leukotriene A4 hydrolase (AFU_orthologue; AFUA_2G07520) |
| AN5811.4 [Search PubMed] | conserved hypothetical protein |
| AN5810.4 [Search PubMed] | hypothetical protein similar to prolidase (Eurofung); Comment: Clutterbuck: gene symbol, EC# |
| AN10737.4 [Search PubMed] | conserved hypothetical protein |
| AN5809.4 [Search PubMed] | conserved hypothetical protein |
| AN5808.4 [Search PubMed] | Putative Zn(II)2Cys6 transcription factor (Eurofung); Comment: Afu orthologue: AFUA_2G07480 |
| AN5807.4 [Search PubMed] | conserved hypothetical protein |
| AN5806.4 [Search PubMed] | RNA polymerase II transcriptional coactivator, putative (AFU_orthologue; AFUA_2G07460) |
| AN10738.4 [Search PubMed] | PaaI_thioesterase family protein, putative (AFU_orthologue; AFUA_4G04355) |
| AN10732.4 [Search PubMed] | PX domain protein (AFU_orthologue; AFUA_2G07450) |
| AN5804.4 [Search PubMed] | DDHD domain protein (AFU_orthologue; AFUA_2G07430) |
| AN5803.4 [Search PubMed] | hypothetical protein similar to fimbrin (Eurofung); Comment: Berl Oakley: Identified as putative fimbrin homolog by Dr. C. Zheng and Dr. B. Liu. Updated January 29, 2007. Pocsi, Miskei, Karanyi: Orthologue of C.albicans:SAC6 involved in response to osmotic stress, product name: Fimbrin, actin-bundling protein |
| AN5802.4 [Search PubMed] | putative RNA binding protein SwoK (Eurofung); Comment: PMID: 16098776. SwoK. Putative RNA binding protein required for the maintenance of hyphal polarity. entered by S. Harris (12/1/2006) |
| AN5801.4 [Search PubMed] | mitochondrial carrier protein, putative (AFU_orthologue; AFUA_2G07400) |
| AN5800.4 [Search PubMed] | 60S ribosomal protein L18 (AFU_orthologue; AFUA_2G07380) |
| AN5799.4 [Search PubMed] | glutamate-5-semialdehyde dehydrogenase (Eurofung); Comment: Flipphi/Clutterbuck: L-glutamate-5-semialdehyde:NADP+ 5-oxidoreductase (phosphorylating) necessary for the biosynthesis of L-proline and L-arginine. hypothetical protein similar (Expect = 1e-90; Identities 52%, Positives 65%) to S. cerevisiae Pro2p gi|1709784|sp|P54885|PROA_YEAST Gamma-glutamyl phosphate reductase (GPR)(Glutamate-5-semialdehyde dehydrogenase)(Glutamyl-gamma-semialdehyde dehydrogenase)(GSA dehydrogenase) gi|1171206|gb|AAA86261|gamma-glutamyl phosphate reductase (Pro2p) PMID:5980118 (A. nidulans proA mutants) PMID:13520441 (mapping of proA mutations) PMID:327767 (mapping of proA mutations) PMID:393802 (effect A. nidulans suppressor mutations on proA mutant) |
| AN5798.4 [Search PubMed] | COP9 subunit 3, putative (AFU_orthologue; AFUA_2G07340); Comment: Similar to GI:5257136: COP9 complex subunit 3 {Homo sapiens}. |
| AN5962.4 [Search PubMed] | conserved hypothetical protein |
| AN5961.4 [Search PubMed] | ATP-dependent protease (CrgA), putative (AFU_orthologue; AFUA_2G10470) |
| AN5960.4 [Search PubMed] | 40S ribosomal protein S14 (Broad) |
| AN5959.4 [Search PubMed] | prephenate dehydrogenase (Eurofung); Comment: M Jones PF02153: Prephenate dehydrogenase RF:XP_755378.1: prephenate dehydrogenase {Aspergillus fumigatus Af293;} (exp=-1; wgp=0; cg=1; genomes=1; ) |
| AN10756.4 [Search PubMed] | cytosolic regulator Pianissimo, putative (AFU_orthologue; AFUA_2G10460); Comment: Pocsi, Miskei, Karanyi: Orthologue of S.pombe:Ste20 involved in cellular response to nitrogen starvation, product name: Sterility protein , EC number: 2.7.11.1 |
| AN10758.4 [Search PubMed] | AAR2 family protein (AFU_orthologue; AFUA_2G10430) |
| AN5957.4 [Search PubMed] | hypothetical branched-chain amino-acid transaminase (Eurofung); Comment: M Jones SP:P47176: Branched-chain-amino-acid aminotransferase, cytosolic (EC 2.6.1.42)(BCAT) (TWT2 protein). {Saccharomyces cerevisiae;} (exp=-1; wgp=-1; cg=-1; genomes=-1; ) |
| AN5956.4 [Search PubMed] | conserved hypothetical protein; Comment: Clutterbuck: 1267 nt 3` overlap with Mariner-1_AN (Kapitonov & Jurka 2003 RepBase reports 3; 194 ) co-ordinates 187348-186188 |
| AN5955.4 [Search PubMed] | Putative Zn(II)2Cys6 transcription factor (Eurofung); Comment: Afu orthologue: AFUA_2G10400 |
| AN10759.4 [Search PubMed] | hypothetical protein |
| AN5954.4 [Search PubMed] | eukaryotic translation initiation factor 3 subunit EifCl, putative (AFU_orthologue; AFUA_2G10380) |
| AN5953.4 [Search PubMed] | iron-sulfur cluster assembly accessory protein Isa2, putative (AFU_orthologue; AFUA_2G10370); Comment: Clutterbuck: 5SrRNA in intron, co-ordinates 178008-178135 |
| AN5952.4 [Search PubMed] | kynureninase (AFU_orthologue; AFUA_2G10360) |
| AN5951.4 [Search PubMed] | ER membrane DUF1077 domain protein, putative (AFU_orthologue; AFUA_2G10350) |
| AN5950.4 [Search PubMed] | AP-2 adaptor complex subunit beta, putative (AFU_orthologue; AFUA_2G10340); Comment: similar to SP:Q10567: Adapter-related protein complex 1 beta 1 subunit (Beta-adaptin 1) [Homo sapiens] (Human) |
| AN5949.4 [Search PubMed] | hypothetical protein |
| AN5948.4 [Search PubMed] | hypothetical protein; Comment: De Groot: Predicted GPI-anchored protein according to Big-PI Fungal Predictor. |
| AN10761.4 [Search PubMed] | cold shock NA binding domain protein (JCVI); Comment: contains a 'Cold-shock' DNA-binding domain similar to major cold shock protein CspA (GI:1778825) [Pseudomonas aeruginosa] PMID: 10515936 |
| AN5947.4 [Search PubMed] | conserved hypothetical protein |
| AN5946.4 [Search PubMed] | conserved hypothetical protein |
| AN5945.4 [Search PubMed] | conserved hypothetical protein |
| AN5944.4 [Search PubMed] | conserved hypothetical protein |
| AN5943.4 [Search PubMed] | conserved hypothetical protein |
| AN5942.4 [Search PubMed] | copper-regulated protein (Eurofung); Comment: Clutterbuck: gene symbol (previously misnamed "acrA"): from NCBI accession # AJ272133 |
| AN5941.4 [Search PubMed] | conserved hypothetical protein |
| AN11495.4 [Search PubMed] | hypothetical protein |
| AN5940.4 [Search PubMed] | DUF636 domain protein (AFU_orthologue; AFUA_1G03180); Comment: Pocsi, Miskei, Karanyi: Orthologue of A.niger:CAJ18284 involved in unfolded protein response, product name: Hypothetical protein |
| AN5939.4 [Search PubMed] | conserved hypothetical protein; Comment: De Groot: Predicted GPI-anchored protein according to Big-PI Fungal Predictor. |
| AN5938.4 [Search PubMed] | conserved hypothetical protein |
| AN5937.4 [Search PubMed] | conserved hypothetical protein |
| AN5936.4 [Search PubMed] | hypothetical protein |
| AN5935.4 [Search PubMed] | MFS phosphate transporter, putative (AFU_orthologue; AFUA_2G10690) |
| AN5934.4 [Search PubMed] | alpha-tubulin suppressor protein Aats1, putative (AFU_orthologue; AFUA_2G10700) |
| AN5933.4 [Search PubMed] | conserved hypothetical protein |
| AN10755.4 [Search PubMed] | catalytic subunit of the DNA polymerase alpha-primase complex (Eurofung); Comment: Pocsi, Miskei, Karanyi: Orthologue of S.cerevisiae:POL1, S.pombe:Pol1 involved in DNA synthesis during DNA repair, gene conversion at mating-type locus, DNA repair synthesis , product name: Catalytic subunit of the DNA polymerase alpha-primase complex , EC number: 2.7.7.7 |
| AN10762.4 [Search PubMed] | thiamin biosynthesis protein (Thi-4), putative (AFU_orthologue; AFUA_2G10740); Comment: Clutterbuck: map position corresponds to thiamin (aneurin) biosynthesis gene anA |
| AN5931.4 [Search PubMed] | RNA helicase (Dbp), putative (AFU_orthologue; AFUA_2G10750) |
| AN5930.4 [Search PubMed] | lysophospholipase A, putative (AFU_orthologue; AFUA_2G10760) |
| AN5929.4 [Search PubMed] | C2H2 transcription factor (Con7), putative (AFU_orthologue; AFUA_2G10770) |
| AN5928.4 [Search PubMed] | hypothetical protein |
| AN5927.4 [Search PubMed] | pentatricopeptide repeat protein (AFU_orthologue; AFUA_2G10790) |
| AN5926.4 [Search PubMed] | Yip1 domain protein (AFU_orthologue; AFUA_2G10800) |
| AN10754.4 [Search PubMed] | nuclear protein export protein Yrb2, putative (AFU_orthologue; AFUA_2G10810) |
| AN10757.4 [Search PubMed] | DEAD/DEAH box helicase, putative (AFU_orthologue; AFUA_2G10820) |
| AN5924.4 [Search PubMed] | Putative Zn(II)2Cys6 transcription factor (Eurofung); Comment: Afu orthologue: AFUA_2G10850 |
| AN11494.4 [Search PubMed] | hypothetical protein |
| AN5923.4 [Search PubMed] | hypothetical protein |
| AN10753.4 [Search PubMed] | phosphoribosylglycinamide formyltransferase (Eurofung); Comment: Clutterbuck: homology with A. niger and N. crassa, plus map position indicate that this is adG, phosphoribosylglycinamide formyltransferase |
| AN10760.4 [Search PubMed] | RING finger protein (AFU_orthologue; AFUA_2G10860) |
| AN5921.4 [Search PubMed] | conserved hypothetical protein |
| AN5920.4 [Search PubMed] | VPS9 domain protein, putative (AFU_orthologue; AFUA_2G10890) |
| AN5919.4 [Search PubMed] | autophagy-related protein Atg15 (Eurofung); Comment: Kiel: Putative lipase GI:40738592 |
| AN5918.4 [Search PubMed] | catalase catC (Eurofung); Comment: identical to catalase C (GI:13378326) [Emericella nidulans] PMID: 11157957 Pocsi, Miskei, Karanyi: Catalase catC, Orthologue of C.albicans:CAT1, S.cerevisiae:CTA1, S.pombe:Ctt1 involved in hydrogen peroxide catabolic process, response to reactive oxygen species, response to oxidative stress, response to heat, product name: Catalase , EC number: 1.11.1.6 |
| AN5917.4 [Search PubMed] | MFS alpha-glucoside transporter, putative (AFU_orthologue; AFUA_2G10910) |
| AN5916.4 [Search PubMed] | enoyl-CoA hydratase (Eurofung); Comment: Clutterbuck: echA: enoyl-CoA hydratase, deletion unable to catabolize valine, isoleucine or short chain fatty acids. PMID: 15554960 |
| AN5915.4 [Search PubMed] | Golgi membrane protein (Rer1), putative (AFU_orthologue; AFUA_2G10930) |
| AN5914.4 [Search PubMed] | conserved hypothetical protein |
| AN5913.4 [Search PubMed] | zinc-binding dehydrogenase family oxidoreductase, putative (JCVI) |
| AN5912.4 [Search PubMed] | ADP ribosylation factor A (Eurofung) |
| AN5911.4 [Search PubMed] | nuclear actin-related protein (Eurofung); Comment: Pocsi, Miskei, Karanyi: Orthologue of S.cerevisiae:ARP8 involved in response to DNA damage stimulus, product name: Nuclear actin-related protein |
| AN5910.4 [Search PubMed] | conserved hypothetical protein |
| AN5909.4 [Search PubMed] | dehydro-orotate deH (Eurofung); Comment: Clutterbuck: confirmed by cloning: U47318; GI:1181886 |
| AN5908.4 [Search PubMed] | conserved hypothetical protein similar to triosephosphate isomerase (Eurofung); Comment: Flipphi Possible second triosephosphate isomerase gene, next to tpiA (accession BAA00908, Broad locus AN6900.3). |
| AN5907.4 [Search PubMed] | conserved hypothetical protein |
| AN5906.4 [Search PubMed] | U-box domain protein, putative (AFU_orthologue; AFUA_2G11040) |
| AN5905.4 [Search PubMed] | conserved hypothetical protein |
| AN5904.4 [Search PubMed] | Acyl CoA binding protein family (AFU_orthologue; AFUA_2G11060) |
| AN5903.4 [Search PubMed] | tyrosyl-DNA phosphodiesterase, putative (AFU_orthologue; AFUA_2G11070) |
| AN5902.4 [Search PubMed] | glucosyltransferase (Die2), putative (AFU_orthologue; AFUA_2G11080); Comment: Geysens: hit obtained after blastp analysis of A. nidulans database using the yeast ALG10/DIE2/YGR227w encoding a Dol-P-Glc: Glc(2)Man(9)GlcNAc(2)-PP- dolichyl glucosyltransferase. Backblastp to yeast database confirms high sequence homology to ALG10 (e-value = 7.5E-40). |
| AN5901.4 [Search PubMed] | DNA replication complex GINS protein (Psf2), putative (AFU_orthologue; AFUA_2G11090) |
| AN5900.4 [Search PubMed] | AMFR protein, putative (AFU_orthologue; AFUA_2G11100) |
| AN5899.4 [Search PubMed] | hypothetical protein similar to condensin subunit (Eurofung); Comment: Clutterbuck: smcB: cut14 homologue, condensin subunit: AF488722; PMID:12482970: repressed alc-promoter fusion unable to condense chromosomes or enter mitosis. |
| AN5898.4 [Search PubMed] | NOT2 family protein (AFU_orthologue; AFUA_2G11130); Comment: similar to hypothetical protein (GI:2213558) {Schizosaccharomyces pombe}. Contains NOT2/NOT3/NOT5 family domain. |
| AN5897.4 [Search PubMed] | 50S ribosomal protein L4 (AFU_orthologue; AFUA_2G11140) |
| AN5896.4 [Search PubMed] | conserved hypothetical protein |
| AN5895.4 [Search PubMed] | secretory pathway gdp dissociation inhibitor (AFU_orthologue; AFUA_2G11150) |
| AN6008.4 [Search PubMed] | conserved hypothetical protein; Comment: Clutterbuck: in overlap contigs 102-103; AN6008.3 is 5`-truncated copy of AN6009.3 |
| AN6007.4 [Search PubMed] | DEAD/DEAH box RNA helicase (Ski2), putative (AFU_orthologue; AFUA_2G10000) |
| AN6006.4 [Search PubMed] | nonsense-mediated mRNA decay protein (Nmd5), putative (AFU_orthologue; AFUA_2G10010) |
| AN6005.4 [Search PubMed] | conserved hypothetical protein |
| AN6004.4 [Search PubMed] | actin cytoskeleton protein (VIP1), putative (AFU_orthologue; AFUA_2G10030) |
| AN6003.4 [Search PubMed] | conserved hypothetical protein |
| AN6002.4 [Search PubMed] | FAD-dependent monooxygenase, putative (AFU_orthologue; AFUA_7G00150) |
| AN6001.4 [Search PubMed] | metallo-beta-lactamase domain protein (AFU_orthologue; AFUA_7G00120) |
| AN6000.4 [Search PubMed] | polyketide synthase, putative (JCVI); Comment: similar to polyketide synthase (GI:19979593) {Aspergillus terreus}. similar to polyketide synthase 1 (GI:24415983){Glarea lozoyensis}. |
| AN5999.4 [Search PubMed] | carbamoyl-phosphate synthetase, arginine-specific large chain (Eurofung); Comment: M Jones David H, Hofmann G, Oliveira AP, Jarmer H, Nielsen J. Metabolic network driven analysis of genome-wide transcription data from Aspergillus nidulans. Genome Biol. 2006;7(11):R108 PMID 17107606 SP:O94313: Carbamoyl-phosphate synthase arginine-specific large chain(EC 6.3.5.5) (Arginine-specific carbamoyl-phosphate synthetase,ammonia chain). {Schizosaccharomyces pombe;} (exp=-1; wgp=-1; cg=-1; genomes=-1; )^|^GB|CAA22122.1|3873545|AL672257 carbamoyl-phosphate synthase; involved in arginine biosynthesis (predicted); involved in glutamate catabolism; carbamoyl-phosphate synthase (glutamine hydrolyzing) activity; localization cytosol; ATP binding domain; similar to S. cerevisiae YJR109C PATH:MAP00240; |
| AN5998.4 [Search PubMed] | SET and MYND domain protein, putative (AFU_orthologue; AFUA_2G10080) |
| AN5997.4 [Search PubMed] | 40S ribosomal protein S15 (Broad) |
| AN5996.4 [Search PubMed] | 60S acidic ribosomal protein P2/allergen Asp F 8 (AFU_orthologue; AFUA_2G10100) |
| AN5995.4 [Search PubMed] | hypothetical protein |
| AN5994.4 [Search PubMed] | YjeF domain protein (AFU_orthologue; AFUA_2G10120) |
| AN5993.4 [Search PubMed] | adhesin, putative (AFU_orthologue; AFUA_2G10130) |
| AN5992.4 [Search PubMed] | DNA replication licensing factor Mcm7, putative (AFU_orthologue; AFUA_2G10140) |
| AN5991.4 [Search PubMed] | peroxisome biogenesis protein peroxin 1 (Eurofung); Comment: Kiel: AAA AtPase; involved in microbody (peroxisome) biogenesis; GI:40738550 |
| AN5990.4 [Search PubMed] | phenylacetyl-CoA ligase, putative (AFU_orthologue; AFUA_2G10160) |
| AN5989.4 [Search PubMed] | conserved hypothetical protein |
| AN5988.4 [Search PubMed] | hypothetical protein |
| AN5987.4 [Search PubMed] | conserved hypothetical protein |
| AN5986.4 [Search PubMed] | NADP(+) coupled glycerol dehydrogenase (Eurofung); Comment: Pocsi, Miskei, Karanyi: Orthologue of C.albicans:ORF19.6757, S.cerevisiae:GCY1 involved in response to salt stress, product name: NADP(+) coupled glycerol dehydrogenase , EC number: 1.1.1.2 |
| AN5985.4 [Search PubMed] | inositol oxygenase, putative (AFU_orthologue; AFUA_2G10230) |
| AN5984.4 [Search PubMed] | NAD binding Rossmann fold oxidoreductase, putative (AFU_orthologue; AFUA_2G10240) |
| AN5983.4 [Search PubMed] | conserved hypothetical protein |
| AN5982.4 [Search PubMed] | Phosphatidylinositol 3-kinase TorA protein, TOR signalling pathway (Eurofung); Comment: similar to Phosphatidylinositol 3-kinase TOR1,(SP:P35169) [Saccharomyces cerevisiae]. Involved in nitrogen regulation. Described in PMID: 16151253 M Jones |
| AN5981.4 [Search PubMed] | SH3 domain protein (AFU_orthologue; AFUA_2G10320) |
| AN5980.4 [Search PubMed] | DUF408 domain protein (AFU_orthologue; AFUA_2G10310) |
| AN5979.4 [Search PubMed] | 40S ribosomal protein S17, putative (AFU_orthologue; AFUA_2G10300) |
| AN5978.4 [Search PubMed] | conserved hypothetical protein |
| AN5977.4 [Search PubMed] | ketoreductase (AFU_orthologue; AFUA_2G10280) |
| AN5976.4 [Search PubMed] | beta-glucosidase (Eurofung); Comment: R.P. de Vries: Function based on sequence similarity CAZY family GH3 |
| AN11497.4 [Search PubMed] | hypothetical protein |
| AN5975.4 [Search PubMed] | hypothetical mannitol-1-phosphate dehydrogenase (Eurofung); Comment: M Jones SP:Q6AHH7 RF:XP_755399.1: mannitol-1-phosphate dehydrogenase {Aspergillus fumigatus Af293;} (exp=-1; wgp=0; cg=1; genomes=1; Pocsi, Miskei, Karanyi: Orthologue of A.niger:MpdA involved in response to heat, response to oxidative stress, response to freezing, product name: Mannitol-1-phosphate dehydrogenase |
| AN10764.4 [Search PubMed] | enoyl-CoA hydratase (AFU_orthologue; AFUA_2G10650) |
| AN10763.4 [Search PubMed] | putative Myb-like transcription factor (Eurofung); Comment: Heinekamp: putative Myb-like transcription factor; Orthologs in A. fumigatus and A. terreus; |
| AN5973.4 [Search PubMed] | serine/threonine protein kinase (YPK1), putative (AFU_orthologue; AFUA_2G10620); Comment: Clutterbuck: pkcB: protein with N-terminal domain similarity to protein kinase C: PMID:16598003 |
| AN5972.4 [Search PubMed] | Coatomer subunit beta´, putative (Eurofung); Comment: T. Pakula: homol. to Coatomer subunit beta' e.g .COPB2_HUMAN, P35606, |
| AN5971.4 [Search PubMed] | NADH-ubiquinone oxidoreductase 299 kDa subunit, putative (AFU_orthologue; AFUA_2G10600) |
| AN5970.4 [Search PubMed] | disulfide isomerase, putative (AFU_orthologue; AFUA_2G10590); Comment: Archer: predicted homologue of Saccharomyces Eps1p, a membrane-bound protein in the ER with similarity in the non-membrane region to protein disulphide isomerase. PDI activity not demonstrated in either yeast or Aspergillus so function in vivo not yet established. |
| AN5969.4 [Search PubMed] | hypothetical protein |
| AN5968.4 [Search PubMed] | amino acid transporter (Eurofung); Comment: Gene product name updated- Ian Paulsen |
| AN5967.4 [Search PubMed] | hypothetical protein |
| AN11496.4 [Search PubMed] | hypothetical protein |
| AN5966.4 [Search PubMed] | Putative C2H2 finger domain transcription factor, hypothetical protein similar to RfeC ; (Eurofung); Comment: Clutterbuck: rfeC: GI:27450539: putative C2H2 zinc finger transcription factor; regulator of FLO11 (Saccharomyces cerevisiae surface flocculin) |
| AN5965.4 [Search PubMed] | hypothetical protein |
| AN6030.4 [Search PubMed] | |
| AN6029.4 [Search PubMed] | conserved hypothetical protein |
| AN6028.4 [Search PubMed] | conserved hypothetical protein |
| AN6027.4 [Search PubMed] | conserved hypothetical protein |
| AN6026.4 [Search PubMed] | conserved hypothetical protein |
| AN6025.4 [Search PubMed] | hypothetical pyrroline-5-carboxylate reductase (Eurofung); Comment: M Jones TIGR00112: pyrroline-5-carboxylate reductase SP:Q12740 GB:BAE55156.1: unnamed protein product; pyrroline-5-carboxylate reductase {Aspergillus oryzae;} (exp=-1; wgp=1; cg=-1; genomes=0; ) |
| AN6024.4 [Search PubMed] | hypothetical protein |
| AN6023.4 [Search PubMed] | oxidoreductase, FAD-binding, putative (AFU_orthologue; AFUA_6G07600) |
| AN6022.4 [Search PubMed] | conserved hypothetical protein |
| AN10768.4 [Search PubMed] | conserved hypothetical protein |
| AN10766.4 [Search PubMed] | conserved hypothetical protein |
| AN6020.4 [Search PubMed] | conserved hypothetical protein |
| AN6019.4 [Search PubMed] | conserved hypothetical protein |
| AN6018.4 [Search PubMed] | conserved hypothetical protein |
| AN10767.4 [Search PubMed] | purine-cytosine permease (AFU_orthologue; AFUA_2G09860) |
| AN10765.4 [Search PubMed] | eukaryotic translation initiation factor 3 subunit EifCg, putative (AFU_orthologue; AFUA_2G09870) |
| AN6016.4 [Search PubMed] | conserved hypothetical protein |
| AN6015.4 [Search PubMed] | Ndt80 homologue ndtA (Eurofung); Comment: Takeshita: Ndt80 homologue ndtA. RF:XP_663619.1: hypothetical protein {Aspergillus nidulans FGSC A4;} (exp=-1; wgp=0; cg=1; genomes=0; ) |
| AN6014.4 [Search PubMed] | fatty acid activator Faa4, putative (AFU_orthologue; AFUA_2G09910) |
| AN6013.4 [Search PubMed] | conserved hypothetical protein |
| AN6012.4 [Search PubMed] | conserved hypothetical protein |
| AN6011.4 [Search PubMed] | hypothetical protein |
| AN6010.4 [Search PubMed] | 70 kDa heat shock protein (Eurofung); Comment: Clutterbuck: sgdE (spore germination deficient) AF180323; PMID:10835388, "yeast hsp70 homolog; similar to Saccharomyces cerevisiae endonuclease SceI" Pocsi, Miskei, Karanyi: Orthologue of S.pombe:Ssc1 involved in response to stress, product name: Hsp70 chaperone mtHsp70 |
| AN6129.4 [Search PubMed] | Putative Zn(II)2Cys6 transcription factor (Eurofung); Comment: Manually curated A.F.J Ram and P.J. Punt; Afu orthologue: AFUA_8G02280 |
| AN6128.4 [Search PubMed] | conserved hypothetical protein |
| AN6127.4 [Search PubMed] | vacuolar ATP synthase 16 kDa proteolipid subunit, putative (AFU_orthologue; AFUA_3G12370) |
| AN11501.4 [Search PubMed] | hypothetical protein |
| AN6126.4 [Search PubMed] | hypothetical protein similar to acetyl-CoA carboxylase (Eurofung); Comment: Clutterbuck: gene symbol, EC# |
| AN6125.4 [Search PubMed] | nuclear distribution protein NUDE (Eurofung); Comment: Berl Oakley: Identified is nudE by Dr. Xin Xiang. Reference: Efimov and Morris (2000) J Cell Biol 150:681-688 |
| AN6124.4 [Search PubMed] | isochorismatase family hydrolase, putative (AFU_orthologue; AFUA_2G08700) |
| AN11500.4 [Search PubMed] | trafficking protein particle complex subunit 2/Sedlin, putative (Eurofung); Comment: Tiina Pakula: homologous to Trafficking complex protein particle component 2, and the closest homologue to TRS20 of S. cerevisiae SP:Q9CQP2: Trafficking protein particle complex protein 2 (Sedlin). {Mus musculus;} (exp=-1; wgp=-1; cg=-1; genomes=-1; )^|^RF|NP_001020136.1|68163405|NM_001024965 trafficking protein particle complex protein 2 {Rattus norvegicus;} (exp=-1; wgp=0; cg=1; genomes=0; )^|^GB|AAH99551.1|68534124|BC099551 trafficking protein particle complex 2 {Mus musculus;} (exp=-1; wgp=0; cg=-1; genomes=0; )^|^GB|AAH91429.1|60552459|BC091429 hypothetical protein LOC287274 {Rattus norvegicus;} (exp=-1; wgp=0; cg=-1; genomes=0; )^|^GB|AAH61087.1|38174617|BC061087 trafficking protein particle complex 2 {Mus musculus;} (exp=-1; wgp=0; cg=-1; genomes=0; )^|^GB|AAH34845.1|22028205|BC034845 trafficking protein particle complex 2 {Mus musculus;} (exp=-1; wgp=0; cg=-1; genomes=0; )^|^GB|AAQ84112.1|35186898|AY318751 spondyloepiphyseal dysplasia tarda protein {Mus musculus;} (exp=-1; w |
| AN6123.4 [Search PubMed] | hypothetical protein |
| AN6121.4 [Search PubMed] | SET domain protein (AFU_orthologue; AFUA_2G08775) |
| AN6120.4 [Search PubMed] | guanyl-nucleotide exchange factor, putative (AFU_orthologue; AFUA_2G08780) |
| AN6119.4 [Search PubMed] | zinc carboxypeptidase, putative (AFU_orthologue; AFUA_2G08790) |
| AN6118.4 [Search PubMed] | amino acid transporter (Eurofung); Comment: Gene product name updated- Ian Paulsen |
| AN6117.4 [Search PubMed] | conserved hypothetical protein |
| AN6116.4 [Search PubMed] | conserved hypothetical protein |
| AN6115.4 [Search PubMed] | nickel transport protein, putative (AFU_orthologue; AFUA_2G08830) |
| AN6114.4 [Search PubMed] | terminal deoxynucleotidyl transferase, putative (AFU_orthologue; AFUA_2G08840) |
| AN6113.4 [Search PubMed] | conserved hypothetical protein |
| AN6112.4 [Search PubMed] | phospholipid P-type ATPase transporter (Eurofung); Comment: gene product name updated- Ian Paulsen |
| AN6111.4 [Search PubMed] | exosome complex endonuclease 2/ribosomal RNA processing protein, putative (AFU_orthologue; AFUA_2G08860) |
| AN6110.4 [Search PubMed] | cell cycle control protein Cwf15, putative (AFU_orthologue; AFUA_2G08870) |
| AN6109.4 [Search PubMed] | hypothetical protein |
| AN6108.4 [Search PubMed] | DHFR, dihydrofolate reductase, cytosolic form (Eurofung); Comment: Pilsyk. gene encoding DHFR, cytosolic dihydrofolate reductase. |
| AN6107.4 [Search PubMed] | ClC chloride ion channel (Eurofung); Comment: gene product name updated- Ian Paulsen Clutterbuck: clcA (GenBank AY247967) |
| AN6106.4 [Search PubMed] | pectate lyase (Eurofung); Comment: R.P.de Vries: function based on sequence similarity CAZY family pl3 |
| AN10773.4 [Search PubMed] | hypothetical protein |
| AN6105.4 [Search PubMed] | conserved hypothetical protein |
| AN6104.4 [Search PubMed] | hypothetical protein |
| AN6103.4 [Search PubMed] | conserved hypothetical protein |
| AN10775.4 [Search PubMed] | Putative Zn(II)2Cys6 transcription factor (Eurofung); Comment: Manually curated A.F.J Ram and P.J. Punt; Afu orthologue: AFUA_6G09580 |
| AN10770.4 [Search PubMed] | RTA1 domain protein, putative (AFU_orthologue; AFUA_6G09550) |
| AN6101.4 [Search PubMed] | cytochrome P450, putative (Eurofung); Comment: Krasevec & Kelly: 5' to short - start earlier; 562 aa MNSLLFREALQHASSTDISKLLLSAATLGVLSHVSLFRSLPVEEYLYGLLGLYTATVVAVTVLYLTATAFSPLQVLLRVGCISAAFNTGLASSIAIYRLFFHRLRRFPGPRLSKLSRFYDAYLAGKG LQYHVEIAEMHKRYGDFFRTGPREICIVRKSAVPLLLSPQSKCGKSTFYAQAQTEAEYCNVHQTRDFEDHRRRRKAWDRGLSVKALATYEPSIRAKADLLVLHIEKNRGRAIDATKWSMFLSFDIMG KVGFGKEFNNLSTGVEHPGIKAIHDHMAILGVMCHVPWLLNLISNLPGASFSMAEFFKWCEDEIVQKHRSWDIKETPQDITSWLLKAYVHKEVSAAPTANALHEDSRAVIVAGSETTATTLASILYF LCKNPEILAKLQLLLDEAMPGGSSEWTYDKIKTISYLDDIINETLRLRPAILTGGYRVTPAEGLQVDEVYIPGDVNVFVPTQLIQTDERYYVDAKRFVPERWNEKKEMIQDGAPYFPFLYGPYVCPK KNLALMSLRISVSKLAQLYDIHFAPGENGELFETRTLDTFTTTLPPLHVQFLSR |
| AN6100.4 [Search PubMed] | conserved hypothetical protein |
| AN6099.4 [Search PubMed] | conserved hypothetical protein |
| AN6098.4 [Search PubMed] | conserved hypothetical protein |
| AN6097.4 [Search PubMed] | conserved hypothetical protein |
| AN6096.4 [Search PubMed] | conserved hypothetical protein |
| AN6095.4 [Search PubMed] | carboxylic acid transport protein (AFU_orthologue; AFUA_2G09450) |
| AN6094.4 [Search PubMed] | thiol methyltransferase, putative (AFU_orthologue; AFUA_4G13570) |
| AN6093.4 [Search PubMed] | acetyl xylan esterase (Eurofung); Comment: R.P. de Vries: function assigned based on activity CAZY family: CE1 |
| AN6092.4 [Search PubMed] | conserved hypothetical protein |
| AN6091.4 [Search PubMed] | Putative Zn(II)2Cys6 transcription factor (Eurofung); Comment: Manually curated A.F.J Ram and P.J. Punt |
| AN6090.4 [Search PubMed] | amino-acid N-acetyltransferase subunit Mak10, putative (AFU_orthologue; AFUA_2G09320) |
| AN11499.4 [Search PubMed] | Mitochondrial ATP synthase epsilon chain domain-containing protein (AFU_orthologue; AFUA_2G09310) |
| AN6089.4 [Search PubMed] | heat shock protein 60, mitochondrial precursor (Eurofung); Comment: Pocsi, Miskei, Karanyi: Orthologue of N.crassa:HSP60, S.pombe:Mcp60 involved in response to stress, response to heat, product name: Mitochondrial heat shock protein |
| AN6088.4 [Search PubMed] | conserved hypothetical protein |
| AN6087.4 [Search PubMed] | mitochondrial carrier protein, putative (AFU_orthologue; AFUA_2G09250) |
| AN6086.4 [Search PubMed] | F-box protein (Pof7), putative (AFU_orthologue; AFUA_2G09240) |
| AN6085.4 [Search PubMed] | ATP-dependent RNA helicase (Hrh1), putative (AFU_orthologue; AFUA_2G09230) |
| AN6084.4 [Search PubMed] | conserved hypothetical protein |
| AN11498.4 [Search PubMed] | hypothetical protein |
| AN6083.4 [Search PubMed] | hypothetical protein similar to ribosomal L10 protein (Broad) |
| AN6082.4 [Search PubMed] | 60S ribosomal protein L30, putative (AFU_orthologue; AFUA_2G09200) |
| AN6081.4 [Search PubMed] | hypothetical protein |
| AN6080.4 [Search PubMed] | Coatomer subunit zeta, putative (Eurofung); Comment: T. Pakula: homol. to Coatomer subunit zeta SP:P53600: Coatomer subunit zeta (Zeta-coat protein) (Zeta-COP). {Saccharomyces cerevisiae;} (exp=-1; wgp=-1; cg=-1; genomes=-1; )^|^RF|NP_015315.1|6325247|NC_001148 Zeta subunit of the coatomer complex (COPI), which coats Golgi-derived transport vesicles; involved in retrograde transport between Golgi and ER {Saccharomyces cerevisiae;} (exp=1; wgp=0; cg=1; genomes=0; )^|^GB|AAB68095.1|965083|U33335 Ypl010wp {Saccharomyces cerevisiae;} (exp=-1; wgp=0; cg=-1; genomes=0; )^|^GB|CAA95031.1|1314066|SCCHRXVI unknown {Saccharomyces cerevisiae;} (exp=-1; wgp=0; cg=-1; genomes=0; )^|^GB|CAA88376.1|683780|SC8132X unknown {Saccharomyces cerevisiae;} (exp=-1; wgp=0; cg=-1; genomes=0; )^|^GB|AAS56764.1|45270766|AY558438 YPL010W {Saccharomyces cerevisiae;} (exp=-1; wgp=0; cg=-1; genomes=0; ) |
| AN10769.4 [Search PubMed] | DUF814 domain protein, putative (AFU_orthologue; AFUA_2G09170) |
| AN10771.4 [Search PubMed] | translation initiation protein Sua5 (AFU_orthologue; AFUA_2G09160) |
| AN6078.4 [Search PubMed] | hypothetical protein similar to adenine deaminase (Eurofung); Comment: Clutterbuck: nadA: adenine deaminase, cloned: AF12360, PMID:14643670 |
| AN6077.4 [Search PubMed] | NADH-ubiquinone oxidoreductase 24 kDa subunit, mitochondrial [Precursor] (Eurofung) |
| AN6076.4 [Search PubMed] | SNF2 family helicase, putative (AFU_orthologue; AFUA_2G09120) |
| AN6075.4 [Search PubMed] | phenylalanine ammonia-lyase (AFU_orthologue; AFUA_2G09110) |
| AN6074.4 [Search PubMed] | polyadenylation factor subunit CstF64, putative (AFU_orthologue; AFUA_2G09100) |
| AN6073.4 [Search PubMed] | putative prohibitin (Eurofung); Comment: Clutterbuck: product and gene symbol: PMID 17030995 |
| AN6072.4 [Search PubMed] | arginine N-methyltransferase (Rmt2), putative (AFU_orthologue; AFUA_2G09080) |
| AN6071.4 [Search PubMed] | DUF221 domain protein, putative (AFU_orthologue; AFUA_2G09070) |
| AN6070.4 [Search PubMed] | hypothetical protein similar to cdc21 (Broad) |
| AN6069.4 [Search PubMed] | DNA ligase (Eurofung); Comment: Pocsi, Miskei, Karanyi: Orthologue of C.albicans:ORF19.6155, S.cerevisiae:CDC9, S.pombe:Cdc17 involved in base-excision repair, nucleotide-excision repair, product name: DNA ligase , EC number: 6.5.1.1 |
| AN6068.4 [Search PubMed] | conserved hypothetical protein |
| AN6067.4 [Search PubMed] | eukaryotic translation initiation factor 5, putative (AFU_orthologue; AFUA_2G08990) |
| AN6066.4 [Search PubMed] | isochorismatase family hydrolase, putative (AFU_orthologue; AFUA_2G08950) |
| AN6065.4 [Search PubMed] | conserved hypothetical protein |
| AN6064.4 [Search PubMed] | GDSL Lipase/Acylhydrolase family protein (AFU_orthologue; AFUA_2G08920) |
| AN6063.4 [Search PubMed] | MFS transporter, putative (AFU_orthologue; AFUA_2G08910) |
| AN6062.4 [Search PubMed] | Putative Zn(II)2Cys6 transcription factor (Eurofung) |
| AN6061.4 [Search PubMed] | Usp (universal stress protein) family protein (Eurofung); Comment: Pocsi, Miskei, Karanyi: Orthologue of S.pombe:SPBC25B2.10 involved in response to stress, product name: Usp (universal stress protein) family protein |
| AN6060.4 [Search PubMed] | eukaryotic translation initiation factor subunit eIF-4F, putative (AFU_orthologue; AFUA_2G09490) |
| AN6059.4 [Search PubMed] | HVA22 domain membrane protein (AFU_orthologue; AFUA_2G09470) |
| AN6058.4 [Search PubMed] | DUF833 domain protein (AFU_orthologue; AFUA_2G09530) |
| AN6057.4 [Search PubMed] | cytochrome P450, putative (Eurofung); Comment: Krasevec & Kelly: ok |
| AN6056.4 [Search PubMed] | conserved hypothetical protein |
| AN6055.4 [Search PubMed] | biotin apo-protein ligase, putative (AFU_orthologue; AFUA_2G09550) |
| AN6054.4 [Search PubMed] | mitochondrial genome maintenance protein Mgm101, putative (AFU_orthologue; AFUA_2G09560); Comment: Pocsi, Miskei, Karanyi: Orthologue of S.cerevisiae:MGM101, S.pombe:Mgm101 involved in DNA repair, product name: Protein involved in mitochondrial genome maintenance |
| AN6053.4 [Search PubMed] | mechanosensitive ion channel, putative (Eurofung); Comment: gene product name updated- Ian Paulsen |
| AN6052.4 [Search PubMed] | conserved hypothetical protein |
| AN6051.4 [Search PubMed] | phytanoyl-CoA dioxygenase family protein (AFU_orthologue; AFUA_2G09620) |
| AN6050.4 [Search PubMed] | conserved hypothetical protein |
| AN6049.4 [Search PubMed] | RING finger domain protein, putative (AFU_orthologue; AFUA_2G09640) |
| AN6048.4 [Search PubMed] | aspartate transaminase (Eurofung); Comment: M Jones cytoplasmic RF:XP_755298.1: aspartate transaminase {Aspergillus fumigatus Af293;} (exp=-1; wgp=0; cg=1; genomes=1;) SP:P00503 |
| AN6047.4 [Search PubMed] | SNARE protein (Ufe1), putative (AFU_orthologue; AFUA_2G09670) |
| AN6046.4 [Search PubMed] | NADPH oxidase complex regulatory component (Eurofung) |
| AN10774.4 [Search PubMed] | conserved hypothetical protein |
| AN6045.4 [Search PubMed] | superoxide dismutase copper chaperone Lys7, putative (AFU_orthologue; AFUA_2G09700) |
| AN6044.4 [Search PubMed] | hypothetical protein similar to protein kinase NPKA (Eurofung); Comment: Clutterbuck: npkA: cdc2-related PITSLRE protein kinase involved in cellular damage response: AAN85729.1; PMID:15342504 Pocsi, Miskei, Karanyi: protein kinase NpkA, Orthologue of GO:0031573 intra-S DNA damage checkpoint , involved in intra-S DNA damage checkpoint , product name: protein kinase |
| AN6043.4 [Search PubMed] | conserved hypothetical protein |
| AN6042.4 [Search PubMed] | conserved hypothetical protein |
| AN6041.4 [Search PubMed] | DUF185 domain protein (AFU_orthologue; AFUA_2G09740) |
| AN6040.4 [Search PubMed] | conserved hypothetical protein |
| AN6039.4 [Search PubMed] | conserved hypothetical protein |
| AN6038.4 [Search PubMed] | hypothetical protein |
| AN6037.4 [Search PubMed] | phosphoglucose isomerase SwoM/PgiA (Eurofung); Comment: Geysens: high sequence homology to yeast PGI1/CDC30/YBR196c (E-value = 1.3E-197) S. Harris (12/1/2006)/M. Flipphi (12/4/2006). Glucose-6-phosphate isomerase (GPI) (Phosphoglucose isomerase) is involved in glycolysis and gluconeogenesis. hypothetical protein similar (Identities 89%, Positives 94%) to Aspergillus oryzae Glucose-6-phosphate isomerase: dbj|BAB12229.1|9955859|glucose-6-phosphate isomerase [Aspergillus oryzae] sp|Q9HGZ2|17366852|G6PI_ASPOR Glucose-6-phosphate isomerase (GPI) (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI) dbj|AB032269.1|9955858|Aspergillus oryzae pgiA mRNA for glucose-6-phosphate isomerase, complete cds. PMID: 16798030. (i.e. description mutant A. nidulans) Phosphoglucose isomerase required for maintenance of hyphal polarity and conidiophore development. Localizes to hyphal tip and septum. |
| AN6036.4 [Search PubMed] | conserved hypothetical protein |
| AN6035.4 [Search PubMed] | mandelate racemase/muconate lactonizing enzyme family protein (AFU_orthologue; AFUA_2G09810) |
| AN6034.4 [Search PubMed] | conserved hypothetical protein |
| AN6033.4 [Search PubMed] | ARF GTPase activator (Glo3), putative (Eurofung); Comment: T. Pakula: homol. to ADP-ribosylation factor GTPase-activating protein GLO3 SP:P38682: ADP-ribosylation factor GTPase-activating protein GLO3. {Saccharomyces cerevisiae;} (exp=-1; wgp=-1; cg=-1; genomes=-1; )^|^RF|NP_011048.1|6320969|NC_001137 ADP-ribosylation factor GTPase activating protein (ARF GAP), involved in ER-Golgi transport; shares functional similarity with Gcs1p {Saccharomyces cerevisiae;} (exp=1; wgp=0; cg=1; genomes=0; )^|^GB|AAC03220.1|603361|SCE9781 Glo3p {Saccharomyces cerevisiae;} (exp=-1; wgp=0; cg=-1; genomes=0; ) |
| AN6032.4 [Search PubMed] | folic acid synthesis protein (AFU_orthologue; AFUA_2G09840) |
| AN6031.4 [Search PubMed] | oxidoreductase, 2-nitropropane dioxygenase family, putative (AFU_orthologue; AFUA_2G09850) |
| AN10785.4 [Search PubMed] | conserved hypothetical protein |
| AN10782.4 [Search PubMed] | mitochondrial phosphate transporter Pic2, putative (AFU_orthologue; AFUA_2G12080) |
| AN6218.4 [Search PubMed] | Putative Zn(II)2Cys6 transcription factor (Eurofung); Comment: Afu orthologue: AFUA_2G12070 |
| AN6217.4 [Search PubMed] | F-box and WD repeat-containing protein (AFU_orthologue; AFUA_2G12060) |
| AN6216.4 [Search PubMed] | ZIP metal ion transporter, putative (AFU_orthologue; AFUA_2G12050) |
| AN6215.4 [Search PubMed] | conserved hypothetical protein |
| AN6214.4 [Search PubMed] | histone acetyltransferase type b catalytic subunit, putative (AFU_orthologue; AFUA_2G12030) |
| AN10781.4 [Search PubMed] | U6 snRNA-associated Sm-like protein LSM4, putative (AFU_orthologue; AFUA_2G12020) |
| AN10784.4 [Search PubMed] | pentatricopeptide repeat protein (AFU_orthologue; AFUA_2G12010) |
| AN10790.4 [Search PubMed] | hypothetical protein; Comment: De Groot: Predicted GPI-anchored protein according to Big-PI Fungal Predictor. |
| AN10780.4 [Search PubMed] | phosphoinositide phosphatase Pten/Tep1, putative (AFU_orthologue; AFUA_2G11990) |
| AN6211.4 [Search PubMed] | hypothetical protein similar to phospholipase A2 (Eurofung); Comment: Clutterbuck: plaA: phospholipase A2: AB101663; PMID:16051517. Deletion has no conspicuous effect on phenotype |
| AN6210.4 [Search PubMed] | Exocyst complex component exo70, putative (Eurofung); Comment: Homol. to exocyst complex protein exo70 {eg. exo70 Asp. fumigatus; EXO70 S. cerevisiae} (tiina Pakula) |
| AN6209.4 [Search PubMed] | adenylosuccinate lyase (Eurofung); Comment: Clutterbuck: homology confirmed in A. niger and N. crassa |
| AN6208.4 [Search PubMed] | conserved hypothetical protein |
| AN11503.4 [Search PubMed] | hypothetical protein |
| AN6207.4 [Search PubMed] | pyruvate dehydrogenase kinase (AFU_orthologue; AFUA_2G11900) |
| AN6206.4 [Search PubMed] | hypothetical protein |
| AN6205.4 [Search PubMed] | conserved hypothetical protein |
| AN10789.4 [Search PubMed] | Putative Zn(II)2Cys6 transcription factor (Eurofung); Comment: Manually curated A.F.J Ram and P.J. Punt |
| AN10779.4 [Search PubMed] | putative 1,6-beta-glucan synthetase (Eurofung); Comment: Klis: hypothetical protein; GH family 16, 1,6-beta-glucan synthesis-associated protein. |
| AN6203.4 [Search PubMed] | conserved hypothetical protein |
| AN6202.4 [Search PubMed] | 60S ribosomal protein L3 (AFU_orthologue; AFUA_2G11850); Comment: Clutterbuck: rpl3: PMID:11179686 |
| AN11502.4 [Search PubMed] | hypothetical protein |
| AN6201.4 [Search PubMed] | conserved hypothetical protein |
| AN10786.4 [Search PubMed] | conserved hypothetical protein |
| AN6200.4 [Search PubMed] | pre-rRNA processing protein Rrp12, putative (AFU_orthologue; AFUA_2G11810) |
| AN6199.4 [Search PubMed] | small nuclear ribonucleoprotein (LSM1), putative (AFU_orthologue; AFUA_2G11800) |
| AN6198.4 [Search PubMed] | conserved hypothetical protein |
| AN6197.4 [Search PubMed] | nuclear migration protein nudF (Eurofung); Comment: Berl Oakley: Verified as nuclear migration protein nudF by Dr. Xin Xiang. Reference: Xiang et al 1995 Mol Biol Cell 6:297-310 |
| AN6196.4 [Search PubMed] | conserved hypothetical protein |
| AN6195.4 [Search PubMed] | CreA, C2H2 finger domain transcription factor (Eurofung); Comment: Clutterbuck: zinc-finger DNA-binding protein; carbon repression creA. GenBank AY219921, PMID 1922072 |
| AN10788.4 [Search PubMed] | hypothetical protein similar to BroA (Eurofung); Comment: Clutterbuck: broA gene cloned AY219921 |
| AN10778.4 [Search PubMed] | mitochondrial DnaJ chaperone (Mdj1), putative (AFU_orthologue; AFUA_2G11750) |
| AN6193.4 [Search PubMed] | mitochondrial serine protease Pim1, putative (AFU_orthologue; AFUA_2G11740); Comment: Similar to SP|P36775|LONM_YEAST ATP-dependent protease Pocsi, Miskei, Karanyi: Orthologue of C.albicans:ORF19.522, S.cerevisiae:PIM1, S.pombe:Lon1 involved in response to heat, product name: Mitochondrial ATP-dependent protease , EC number: 3.6.1.3, 3.4.21.53 |
| AN6192.4 [Search PubMed] | Protein kinase domain-containing protein (AFU_orthologue; AFUA_2G11730) |
| AN6191.4 [Search PubMed] | CobW domain protein (AFU_orthologue; AFUA_2G11720) |
| AN6190.4 [Search PubMed] | Mob1 family protein (AFU_orthologue; AFUA_2G11710) |
| AN6189.4 [Search PubMed] | HIT domain protein (AFU_orthologue; AFUA_2G11700); Comment: Clutterbuck: inlcudes "bristle response element" LC13 GenBank X70249, PMID 8417986 |
| AN6188.4 [Search PubMed] | HD family hydrolase, putative (AFU_orthologue; AFUA_2G11680) |
| AN6187.4 [Search PubMed] | conserved hypothetical protein |
| AN6186.4 [Search PubMed] | hypothetical DNA excision repair complex component (Eurofung); Comment: M Jones PF03835: DNA repair protein Rad4 GB:BAE59923.1: unnamed protein product; nucleotide excision repair complex XPC-HR23B, subunit XPC/DPB11 {Aspergillus oryzae;} (exp=-1; wgp=1; cg=-1; genomes=0; ) Pocsi, Miskei, Karanyi: Orthologue of S.pombe:Rhp42 involved in nucleotide-excision repair, mismatch repair, product name: DNA repair protein |
| AN6185.4 [Search PubMed] | conserved hypothetical protein |
| AN10783.4 [Search PubMed] | 6-phosphogluconate dehydrogenase family protein (AFU_orthologue; AFUA_2G11600) |
| AN10777.4 [Search PubMed] | UDP-glucoronosyl and UDP-glucosyl transferase family protein (AFU_orthologue; AFUA_2G11590) |
| AN6183.4 [Search PubMed] | F-box domain protein (AFU_orthologue; AFUA_2G11570) |
| AN6182.4 [Search PubMed] | galactose-1-phosphate uridylyltransferase (AFU_orthologue; AFUA_2G11560); Comment: Geysens: Only hit found when performing blastp analysis against the A. nidulans database using yeast GAL7/YBR018c (= UTP--hexose 1-phosphate uridylyltransferase). Significant sequence homology is confirmed after backblast of AN6182.3 to yeast database: GAL& is only significant hit with e-value = 1.8E-100. Clutterbuck: position and homology fit galD: galactose-1-phosphate uridyltransferase: PMID:13974285 |
| AN6181.4 [Search PubMed] | 60S ribosomal protein L44 P (Broad) |
| AN6180.4 [Search PubMed] | hypothetical protein similar to SPBC24C6.01c (Broad) |
| AN6179.4 [Search PubMed] | hypothetical protein similar to SPBC24C6.01c (Broad) |
| AN6178.4 [Search PubMed] | RNA polymerase II transcription factor SIII (Elongin) subunit A, putative (AFU_orthologue; AFUA_2G08170) |
| AN6177.4 [Search PubMed] | flotillin domain protein (AFU_orthologue; AFUA_2G08180) |
| AN6176.4 [Search PubMed] | tubulin-specific chaperone Rbl2, putative (AFU_orthologue; AFUA_2G08190) |
| AN6175.4 [Search PubMed] | conserved hypothetical protein |
| AN6174.4 [Search PubMed] | conserved hypothetical protein |
| AN6173.4 [Search PubMed] | Putative Zn(II)2Cys6 transcription factor (Eurofung); Comment: Manually curated A.F.J Ram and P.J. Punt; Afu orthologue: AFUA_2G08240 |
| AN6172.4 [Search PubMed] | hypothetical protein |
| AN6171.4 [Search PubMed] | U3 small nucleolar ribonucleoprotein subunit (Imp3), putative (AFU_orthologue; AFUA_2G08320) |
| AN6170.4 [Search PubMed] | DnaJ domain protein, putative (AFU_orthologue; AFUA_2G08300); Comment: Pocsi, Miskei, Karanyi: Orthologue of S.pombe:SPBC1347.05c involved in unfolded protein response, product name: One of several homologs of bacterial chaperone DnaJ |
| AN6169.4 [Search PubMed] | conserved hypothetical protein |
| AN6168.4 [Search PubMed] | hypothetical protein similar to NADP-dependent malic enzyme (Eurofung); Comment: Flipphi L-malate:NADP+-oxidoreductase; oxaloacetate decarboxylating gb|AAN63880.1|24637711|NADP-dependent malic enzyme [Aspergillus nidulans] gb|AF529885.1|24637710|Aspergillus nidulans NADP-dependent malic enzyme (maeA) gene, complete cds; nuclear gene for mitochondrial product. NB. Clear homologues of this enzyme appear to be absent in yeasts. PMID: 4153143 (enzyme measurements in A. Nidulans) Clutterbuck: also called acuM |
| AN6167.4 [Search PubMed] | FMN binding oxidoreductase, putative (AFU_orthologue; AFUA_2G08260) |
| AN6166.4 [Search PubMed] | transcription factor TFIIE complex alpha subunit, putative (AFU_orthologue; AFUA_2G08450) |
| AN6165.4 [Search PubMed] | tRNA pseudouridine synthase, putative (AFU_orthologue; AFUA_2G08460) |
| AN6164.4 [Search PubMed] | ubiquitin C-terminal hydrolase, putative (AFU_orthologue; AFUA_2G08440) |
| AN6163.4 [Search PubMed] | conserved hypothetical protein |
| AN6162.4 [Search PubMed] | hypothetical protein similar to TPA: prenylcystein carboxymethyl transferase (Eurofung); Comment: Clutterbuck: ste14: hypothetical pheromone processing prenylcysteine carboxymethyl transferase: BK001301; PMID:12949156 |
| AN6161.4 [Search PubMed] | microbody (peroxisome) biogenesis protein peroxin 8 (Eurofung); Comment: Kiel: PTS1 containing protein GI:40738757 |
| AN6160.4 [Search PubMed] | WD repeat protein (AFU_orthologue; AFUA_2G08390) |
| AN6159.4 [Search PubMed] | diacylglycerol O-acyltransferase (DgaT), putative (AFU_orthologue; AFUA_2G08380) |
| AN6158.4 [Search PubMed] | glutathione S-transferase, putative (AFU_orthologue; AFUA_2G08370) |
| AN6157.4 [Search PubMed] | orotidine MP decarboxylase (Eurofung); Comment: Clutterbuck: confirmed by cloning: M19132; GI:2317819, PMID:3328733 |
| AN6156.4 [Search PubMed] | conserved hypothetical protein; Comment: Clutterbuck: 1578 nt 3` overlap with incomplete Mariner-3_AN (Kapitonov & Jurka 2003 RepBase reports 3; 196 ) co-ordinates 90211-88521 |
| AN6155.4 [Search PubMed] | conserved hypothetical protein |
| AN6154.4 [Search PubMed] | C6 finger domain protein, putative (AFU_orthologue; AFUA_8G01940) |
| AN6153.4 [Search PubMed] | conserved hypothetical protein |
| AN6152.4 [Search PubMed] | hypothetical protein |
| AN6151.4 [Search PubMed] | carboxyphosphonoenolpyruvate phosphonomutase-like protein (AFU_orthologue; AFUA_5G07230) |
| AN6150.4 [Search PubMed] | GTP binding protein (Bud4), putative (AFU_orthologue; AFUA_2G08470); Comment: Possible homologue of Saccharomyces cerevisiae bud site selection protein Bud4. entered by S. Harris (11/30/2006) |
| AN6149.4 [Search PubMed] | ATP-dependent RNA helicase Mrh4, putative (AFU_orthologue; AFUA_2G08480) |
| AN6148.4 [Search PubMed] | carboxylesterase, putative (AFU_orthologue; AFUA_2G08500) |
| AN6147.4 [Search PubMed] | SET domain protein (AFU_orthologue; AFUA_2G08510) |
| AN6146.4 [Search PubMed] | 50S ribosomal protein L14 (AFU_orthologue; AFUA_2G08520) |
| AN6145.4 [Search PubMed] | hypothetical protein similar to peptidyl-prolyl cis/trans isomerase (Eurofung); Comment: Clutterbuck: pinA; mitotic peptidyl-prolyl isomerase cloned: AF035768, PMID:9482729 |
| AN6144.4 [Search PubMed] | conserved hypothetical protein |
| AN6143.4 [Search PubMed] | Nuclear pore complex protein An-Nup82 (Eurofung); Comment: Steve Osmani. Identified as a protein with similarity to S. cerevisiae nuclear pore complex (NPC) protein NUP82. Endogenously tagged protein locates to the NPC during interphase but disperses from the NPC during mitosis. Essential. Contains C-terminal coiled coils. PMID: 16987955 PMID: 15611647 |
| AN6142.4 [Search PubMed] | small subunit of nuclear cap-binding protein complex (AFU_orthologue; AFUA_2G08570) |
| AN6141.4 [Search PubMed] | hypothetical protein similar to pyridoxine (Eurofung); Comment: Clutterbuck: pyroB: cloned AF363613; GI:13937024; homology confirmed in A. niger |
| AN6140.4 [Search PubMed] | phosphopantetheinyl transferase (Eurofung); Comment: turner: RF:XP_663744.1: hypothetical protein {Aspergillus nidulans FGSC A4;} GB|AAF12814.1|6466182|AF198117 NpgA protein {Emericella nidulans;} Phosphopantetheinyl transferase for addition of cofactor to NRPS and PKS enzymes of secondary metabolism PMID: 12664133 Required for lysine biosynthesis and iron acquisition PMID: 14508603 Orthologue of Saccharomyces LYS5 PMID: 12127488 |
| AN6139.4 [Search PubMed] | hypothetical protein similar to AtaAp (Eurofung); Comment: Clutterbuck: gene symbol: ataA GenBank accession AF141864 |
| AN6138.4 [Search PubMed] | protein bimA (Eurofung); Comment: Clutterbuck: gene symbols bimA and sepI: X59269. Component of anaphase promoting complex, DNA damage checkpoint: PMID: 10628978, 1770001 Pocsi, Miskei, Karanyi: Orthologue of S.pombe:Nuc2 involved in cell cycle arrest in response to nitrogen starvation, product name: Anaphase-promoting complex subunit |
| AN6137.4 [Search PubMed] | conserved hypothetical protein |
| AN6136.4 [Search PubMed] | RING finger membrane protein (AFU_orthologue; AFUA_2G08650) |
| AN6135.4 [Search PubMed] | conserved hypothetical protein |
| AN6134.4 [Search PubMed] | conserved hypothetical protein |
| AN6133.4 [Search PubMed] | conserved hypothetical protein |
| AN6132.4 [Search PubMed] | conserved hypothetical protein |
| AN10776.4 [Search PubMed] | cytochrome P450, putative (Eurofung); Comment: Krasevec & Kelly: intron boundary should be in the same location on CYP619B1 and CYP619B2; 542 aa MNSLPLLLAAAFVGFLYVFLTKGRREKGLPSGPPTLPILGNLHQIPVKGSYLKFTEWASQYGGLYSLKLGTGTAIVITDPRLVKEVIDRKSSKYSNRPDSFVAHTITGGSHLLVMQYGPLWRTMRKL VHQHFMETAVEKSHIHVQNAEAVQMLRDFCVRPDQHMLHPKRYSNSIIMSLVYGVRTPSVHTAHMTQLYEMMGCRLTMRPSSFQERWSKVMEPGNTPPVDIYSFLHYIPQKVFGNWLSRAKGVRDEM CQLYGQYLDLVDSRRKKVGSTGSFMDTVLDQNEKLGLTRHQLYFLGGVLMEGGSDTSSSIILAFIHAMTKWPQVLKKAQAEIDSVVGEDRTPVWSDYGSLPYVAATVKEAMRWRPAVPLAFPHAAAE DDWVDGHFIPKGSTVIISGWGMHHNEARFGNPSVFDPDHYKGQTALAPELANASDYTARDHYGYGTGRRICPGIHVAERNLFLAISKLIWAFSIEPGVDESGKLIEPDLHPTTGYSEGFLVCANDFP CRIMPRSERRRETIMKEYQRAQEEVFSRFENISS |
| AN10787.4 [Search PubMed] | conserved hypothetical protein |
| AN6130.4 [Search PubMed] | conserved hypothetical protein |
| AN6235.4 [Search PubMed] | enoyl-CoA hydratase/isomerase family protein (AFU_orthologue; AFUA_3G03410) |
| AN6234.4 [Search PubMed] | siderophore biosynthesis acetylase AceI, putative (AFU_orthologue; AFUA_3G03400) |
| AN6233.4 [Search PubMed] | DnaJ domain protein (AFU_orthologue; AFUA_2G13210) |
| AN6232.4 [Search PubMed] | vacuolar ATP synthase subunit B (Eurofung); Comment: 3'-part of gene is perfect hit to AF236667 (which is only a 3'-partial of the CDS); added gene symbol; added EC number - Gerald Hofmann |
| AN6231.4 [Search PubMed] | tryptophan synthetase (Eurofung); Comment: Clutterbuck: confirmed by cloning tryptophan synthase-encoding trpB gene find in PMID: 10905354 Helmstaedt: expression regulated by cross-pathway control |
| AN6230.4 [Search PubMed] | medusa (Eurofung); Comment: Takeshita; developmental regulator medA (medusa). GB:AAC31205.1: Medusa GB|BAD02337.1|38524425|AB103458 medusa RF:XP_663834.1: PMID: 2283502, 8722771 |
| AN10796.4 [Search PubMed] | conserved hypothetical protein |
| AN10793.4 [Search PubMed] | alcohol dehydrogenase, putative (AFU_orthologue; AFUA_2G13270) |
| AN6228.4 [Search PubMed] | GYF domain protein (AFU_orthologue; AFUA_2G13290) |
| AN6227.4 [Search PubMed] | aminotransferase family protein (LolT), putative (AFU_orthologue; AFUA_2G13295) |
| AN10795.4 [Search PubMed] | conserved hypothetical protein |
| AN10792.4 [Search PubMed] | RING finger domain protein, putative (AFU_orthologue; AFUA_2G13310) |
| AN6225.4 [Search PubMed] | mitochondrial membrane fission protein (Fis1), putative (AFU_orthologue; AFUA_2G13320) |
| AN6224.4 [Search PubMed] | hypothetical protein |
| AN6223.4 [Search PubMed] | RNA polymerase II transcription mediator complex subunit Srb7, putative (AFU_orthologue; AFUA_2G13350) |
| AN10794.4 [Search PubMed] | single-stranded DNA-dependent ATPase (Eurofung); Comment: Pocsi, Miskei, Karanyi: Orthologue of S.cerevisiae:RAD5, S.pombe:SPAC17A2.12 involved in DNA repair, double-strand break repair, product name: Single-stranded DNA-dependent ATPase |
| AN10791.4 [Search PubMed] | phosphatidylinositol 4-kinase type II subunit alpha, putative (AFU_orthologue; AFUA_2G13370) |
| AN6221.4 [Search PubMed] | GATA factor AREB (Eurofung); Comment: identical to GATA factor AREB alpha (GI:12232019) {Aspergillus nidulans} note: gene is alternatively spliced alternative splice form: GI:12232017: GATA factor AREB gamma{Aspergillus nidulans} alternative splice form: GI:12232018: GATA factor AREB beta {Aspergillus nidulans} PFAM GATA domain (PF00320) 17-51 (1.5e-18) |
| AN6220.4 [Search PubMed] | MFS transporter, putative (AFU_orthologue; AFUA_2G13390) |
| AN11504.4 [Search PubMed] | hypothetical protein; Comment: Clutterbuck: 37 nt 3` overlap with 217 nt copia-2_AN fragment (Kapitonov & Jurka 2003 RepBase reports 3; 199 ) co-ordinates 1450-1234 |
| AN6381.4 [Search PubMed] | conserved hypothetical protein |
| AN6380.4 [Search PubMed] | conserved hypothetical protein |
| AN6379.4 [Search PubMed] | hypothetical protein |
| AN6378.4 [Search PubMed] | conserved hypothetical protein |
| AN6377.4 [Search PubMed] | conserved hypothetical protein |
| AN6376.4 [Search PubMed] | conserved hypothetical protein |
| AN6375.4 [Search PubMed] | tafazzin (AFU_orthologue; AFUA_2G13960) |
| AN6374.4 [Search PubMed] | ATP dependent RNA helicase (Dbp9), putative (AFU_orthologue; AFUA_2G13980) |
| AN6373.4 [Search PubMed] | conserved hypothetical protein |
| AN6372.4 [Search PubMed] | conserved hypothetical protein |
| AN6371.4 [Search PubMed] | conserved hypothetical protein |
| AN6370.4 [Search PubMed] | hypothetical protein |
| AN6369.4 [Search PubMed] | ABC transporter, putative (Eurofung); Comment: gene product name updated- Ian Paulsen |
| AN6368.4 [Search PubMed] | arginyl-tRNA synthetase (AFU_orthologue; AFUA_2G14030) |
| AN6367.4 [Search PubMed] | conserved hypothetical protein |
| AN6366.4 [Search PubMed] | NADH-cytochrome b5 reductase (AFU_orthologue; AFUA_2G14060) |
| AN6365.4 [Search PubMed] | conserved hypothetical protein |
| AN6364.4 [Search PubMed] | chromosome segregation protein sudA (Eurofung); Comment: Clutterbuck: sudA: suppressor of bimD6: U40146; PMID:8849887 |
| AN6363.4 [Search PubMed] | hypothetical protein similar to extragenic suppressor of the bimD6 mutation (Eurofung); Comment: Clutterbuck: sudD: suppressor of bimD6: AF013590; PMID8849887 |
| AN6362.4 [Search PubMed] | arsenate reductase (Arc2), putative (AFU_orthologue; AFUA_6G13400) |
| AN6361.4 [Search PubMed] | conserved hypothetical protein |
| AN6360.4 [Search PubMed] | autophagy-related protein Atg17 (Eurofung); Comment: Kiel: Autophagy related kinase activator GI:40739554 |
| AN6359.4 [Search PubMed] | SconB, sulfur metabolite repression control protein (Eurofung); Comment: Clutterbuck: SconB: sulphur metabolism regulator containing WD40 repeats and F-box. U21220; GI:1041197; PMID:8479426, 9520259 |
| AN6358.4 [Search PubMed] | conserved hypothetical protein |
| AN6357.4 [Search PubMed] | hypothetical protein |
| AN6356.4 [Search PubMed] | conserved hypothetical protein |
| AN6355.4 [Search PubMed] | hypothetical protein |
| AN6354.4 [Search PubMed] | ubiquitin C-terminal hydrolase, putative (AFU_orthologue; AFUA_2G14130) |
| AN6353.4 [Search PubMed] | acetyltransferase, GNAT family family (AFU_orthologue; AFUA_3G07750) |
| AN6352.4 [Search PubMed] | endoarabinanase (Eurofung); Comment: R.P. de Vries: Function based on activity CAZY family gh43 |
| AN6351.4 [Search PubMed] | autophagy protein Atg20, putative (AFU_orthologue; AFUA_2G14160) |
| AN6350.4 [Search PubMed] | hypothetical protein |
| AN6349.4 [Search PubMed] | HEAT repeat protein (AFU_orthologue; AFUA_2G14180) |
| AN6348.4 [Search PubMed] | Mitochondrial import inner membrane translocase subunit TIM23, putative (AFU_orthologue; AFUA_2G14190) |
| AN6347.4 [Search PubMed] | protein kinase, putative (AFU_orthologue; AFUA_2G14200) |
| AN6346.4 [Search PubMed] | hypothetical dihydroxy-acid dehydratase (Eurofung); Comment: M Jones TIGR00110: dihydroxy-acid dehydratase RF:XP_755754.1: mitochondrial dihydroxy acid dehydratase {Aspergillus fumigatus Af293;} (exp=-1; wgp=0; cg=1; genomes=1;) |
| AN6345.4 [Search PubMed] | vacuolar protein sorting protein Vps66, putative (AFU_orthologue; AFUA_2G14220) |
| AN6344.4 [Search PubMed] | MFS transporter, putative (AFU_orthologue; AFUA_2G14230) |
| AN10801.4 [Search PubMed] | conserved hypothetical protein |
| AN10809.4 [Search PubMed] | putative CCAAT-box-binding transcription factor (Eurofung) |
| AN6342.4 [Search PubMed] | hypothetical protein |
| AN6341.4 [Search PubMed] | putative coronin homolog (Eurofung); Comment: Berl Oakley: putative coronin homolog. Identified by Dr. C. Zheng and Dr. B. Liu. Updated January 29, 2007. |
| AN6340.4 [Search PubMed] | KLPA (kinesin class 14) (Eurofung); Comment: Berl Oakley: KLPA c-terminal motor domain kinesin class 14. Minus end directed motor. Reference: Prigozhina NL Mol Biol Cell. 2001 Oct;12(10):3161-74. |
| AN6339.4 [Search PubMed] | PAK-related kinase (Eurofung); Comment: Pocsi, Miskei, Karanyi: Orthologue of S.pombe:Nak1 involved in response to stress, product name: PAK-related kinase , EC number: 2.7.11.1 |
| AN6338.4 [Search PubMed] | hypothetical amino acid aminotransferase (Eurofung); Comment: M Jones RF:XP_719544.1: aromatic amino acid aminotransferase I {Candida albicans SC5314;} (exp=-1; wgp=0; cg=1; genomes=0; ) Possibly role tryptophan, phenylalanine, and tyrosine catabolism; Lysine biosynthesis |
| AN6337.4 [Search PubMed] | conserved hypothetical protein |
| AN10800.4 [Search PubMed] | mitochondrial pyruvate dehydrogenase kinase, putative (AFU_orthologue; AFUA_2G13600) |
| AN10808.4 [Search PubMed] | thiamine pyrophosphate enzyme, putative (AFU_orthologue; AFUA_2G13620) |
| AN6335.4 [Search PubMed] | conserved hypothetical protein |
| AN6334.4 [Search PubMed] | ribosome biogenesis protein (Bms1), putative (AFU_orthologue; AFUA_2G13570) |
| AN6333.4 [Search PubMed] | conserved hypothetical protein |
| AN6332.4 [Search PubMed] | lactoylglutathione lyase (Glo1), putative (AFU_orthologue; AFUA_2G13550) |
| AN6331.4 [Search PubMed] | CCCH zinc finger and RRM domain protein (AFU_orthologue; AFUA_2G13540) |
| AN6330.4 [Search PubMed] | elongation factor 2 (Eurofung); Comment: M Jones TIGR00490: RF:XP_663934.1: elongation factor 2 {Aspergillus nidulans FGSC A4;} (exp=-1; wgp=0; cg=1; genomes=0; ) RF:NP_001952.1: eukaryotic translation elongation factor 2 {Homo sapiens;} (exp=-1; wgp=0; cg=1; genomes=0; ) |
| AN6329.4 [Search PubMed] | fermentation associated protein (Csf1), putative (AFU_orthologue; AFUA_2G13520) |
| AN6328.4 [Search PubMed] | DUF300 domain protein (AFU_orthologue; AFUA_2G13512) |
| AN6327.4 [Search PubMed] | hypothetical protein |
| AN10807.4 [Search PubMed] | KH domain protein (AFU_orthologue; AFUA_2G13490) |
| AN10799.4 [Search PubMed] | conserved hypothetical protein |
| AN6325.4 [Search PubMed] | pyrimidine 5'-nucleotidase, putative (AFU_orthologue; AFUA_2G13470) |
| AN6324.4 [Search PubMed] | alpha-amylase, putative (AFU_orthologue; AFUA_2G13460); Comment: De Groot: predicted GPI-anchored protein according to BIG-PI fungal predictor with similarity to alpha-amylase AmyA (Aspergillus fumigatus Af293). CAZY family GH13. Possibly involved in alpha-glucan remodeling. Clutterbuck: PMID:17031028 R.P. de Vries: function based on sequence similarity. CAZY family GH13. Protein contains GPI anchor. |
| AN6323.4 [Search PubMed] | p150 dynactin (NUDM) (Eurofung); Comment: Berl Oakley: Confirmed as p150 dynactin NUDM by Dr. Xin Xiang. Reference: Zhang, et al. (2003) Mol. Biol. Cell 14: 1479-1488. |
| AN6322.4 [Search PubMed] | Putative Zn(II)2Cys6 transcription factor (Eurofung); Comment: Manually curated A.F.J Ram and P.J. Punt |
| AN6321.4 [Search PubMed] | cytochrome P450, putative (Eurofung); Comment: Krasevec & Kelly: 5' to short and 3' to long; 433 aa MSAVLLGKRYVSTPDPENIKAVLATKFVDFDLGERNAAFRPLLETGVFTQDGREWERSRALLRPIFNRAQALPDLLLIEEHVQSRLYRIPRGYDIVNLQQLVRDLTLDSAFIHFLAGRPAKIAGSRR GDFDAEPFSHAFDEARSYLQVRANLGPFRGLVKNTKFVDDVIVHAAVDEFVYEALEQRRSPAHENRGKLGRGCGNESESEGWYDLLSKVADTVSDGVQIRSQLLHVLLAARDTTARLLSSVFYMLAR HPSVWRKLEREVLVEFGLATQGDGKCPLPTYTQLREMKYVRAVLNEALRLLPPVPTNIRCATQHTFLPRGGGVDGCQPIFVAKKAIVHYSAEQMQRFTEIYGDDAEQFRPERWVPLRRGWGFLPFSG GPRICLGQQKALTEAVYVVVRMVQTFCDIEARDERPWREQMGLVLSSYYGVKVGLKSRNGGS |
| AN6320.4 [Search PubMed] | hypothetical protein similar to fatty acid oxygenase (Eurofung); Comment: Clutterbuck: ppoB: AY940146; GI:60687493 ; PMID:15941990: fatty acid oxygenase involved in biosynthesis of psi factors regulating sexual and asexual reproduction |
| AN6319.4 [Search PubMed] | conserved hypothetical protein |
| AN6318.4 [Search PubMed] | chitin synthase csmA (Eurofung); Comment: identical to GI:2308977: chitin synthase {Aspergillus nidulans} PMID: 9223429 10368147 12379226 Berl Oakley: is csmA. Note it has a myosin domain as well as a chitin synthase domain. Clutterbuck: Class V chitin synthase, also named chsD (PMID: 8810520), but not entered as alias to avoid confusion with AN1555 Pocsi, Miskei, Karanyi: Orthologue of C.albicans:CHS3 involved in response to osmotic stress, product name: Major chitin synthase , EC number: 2.4.1.16 |
| AN6317.4 [Search PubMed] | chitin synthase myosin fusion (Eurofung); Comment: similar to GI:16660468: chitin synthase {Aspergillus oryzae}. Berl Oakley: A. nidulans csmB gene ref. Takeshita N et al. (2006) Mol Microbiol. 59: 1380-1394. Contains a chitin synthase and a myosin motor domain. (information from Dr. Naimeh Taheri-Talesh). Hiroyuki Horiuchi: Class VI chitin synthase. Acc. No. AB230981 Pocsi, Miskei, Karanyi: Orthologue of C.albicans:CHS3 involved in response to osmotic stress, product name: Major chitin synthase , EC number: 2.4.1.16 |
| AN6316.4 [Search PubMed] | ATP-binding protein (Eurofung); Comment: Pocsi, Miskei, Karanyi: Orthologue of S.pombe:Pms1 involved in mismatch repair, product name: ATP-binding protein required for mismatch repair in mitosis and meiosis |
| AN6315.4 [Search PubMed] | conserved hypothetical protein |
| AN6314.4 [Search PubMed] | short-chain dehydrogenase/reductase family protein, putative (AFU_orthologue; AFUA_3G01250) |
| AN11507.4 [Search PubMed] | hypothetical protein |
| AN10806.4 [Search PubMed] | YagE family protein (AFU_orthologue; AFUA_2G12110) |
| AN10798.4 [Search PubMed] | conserved hypothetical protein |
| AN6312.4 [Search PubMed] | conserved hypothetical protein |
| AN6311.4 [Search PubMed] | ClC chloride ion channel (Eurofung); Comment: gene product name updated- Ian Paulsen |
| AN6310.4 [Search PubMed] | midasin, putative (AFU_orthologue; AFUA_2G12150) |
| AN6309.4 [Search PubMed] | conserved hypothetical protein |
| AN6308.4 [Search PubMed] | hypothetical protein |
| AN6307.4 [Search PubMed] | lectin family integral membrane protein, putative (AFU_orthologue; AFUA_2G12180) |
| AN6306.4 [Search PubMed] | mitochondrial intermembrane space translocase subunit Tim13, putative (AFU_orthologue; AFUA_2G12190) |
| AN6305.4 [Search PubMed] | hypothetical protein similar to cAMP-dependent protein kinase PKA catalytic subunit (Eurofung); Comment: Helmstaedt: RF:XP_663909.1: hypothetical protein {Aspergillus nidulans FGSC A4;} GB|AAF75762.1|8489808|AF262987 cAMP-dependent protein kinase PKAC catalytic subunit {Emericella nidulans;} PMID: 11156981, PMID: 14668367, PMID: 16087751 Clutterbuck: also called pkaC in AF262987 Pocsi, Miskei, Karanyi: Orthologue of A.niger:PkaC, C.albicans:TPK2, S.pombe:Pka1 involved in response to stress, age-dependent response to reactive oxygen species, cellular response to nitrogen starvation, induction of conjugation upon nitrogen starvation, response to heat, response to osmotic stress, product name: cAMP-dependent protein kinase catalytic subunit , EC number: 2.7.11.11, 2.7.1.37 |
| AN6304.4 [Search PubMed] | stress activated MAP kinase interacting protein, putative (AFU_orthologue; AFUA_2G12210) |
| AN6303.4 [Search PubMed] | hypothetical protein similar to replication factor C protein (Eurofung); Comment: Clutterbuck: uvsF (UV-sensitive) cloned: U86619, U86620: PMID:9218714: "replication factor C like protein". Prevously called "uvsB" in PMID 5807344, but changed to avoid confusion with uvsB, now identified as AN6975 Pocsi, Miskei, Karanyi: Subunit of heteropentameric Replication factor C (RF-C) UvsF, Orthologue of C.albicans:RFC1, S.cerevisiae:RFC1, S.pombe:Rfc1 involved in mismatch repair, DNA repair, nucleotide-excision repair , product name: Subunit of heteropentameric Replication factor C (RF-C) , EC number: 6.5.1.2 |
| AN6302.4 [Search PubMed] | hypothetical protein similar to mitochondrial ribosomal protein L16 (Eurofung); Comment: identical to mitochondrial ribosomal protein L16 (GI:40557594) [Emericella nidulans] similar to GI:18376022: related to ribosomal protein L16 precursor, mitochondrial {Neurospora crassa} Clutterbuck: gene symbol mrpA: AY496259 |
| AN6301.4 [Search PubMed] | conserved hypothetical protein |
| AN6300.4 [Search PubMed] | DNA replication factor C subunit Rfc5, putative (AFU_orthologue; AFUA_2G12250); Comment: Pocsi, Miskei, Karanyi: Orthologue of C.albicans:ORF19.2029, S.cerevisiae:RFC5, S.pombe:Rfc5 involved in mismatch repair, DNA repair, product name: Subunit of heteropentameric Replication factor C (RF-C) |
| AN6299.4 [Search PubMed] | DUF803 domain membrane protein (AFU_orthologue; AFUA_2G07880) |
| AN6298.4 [Search PubMed] | hypothetical protein |
| AN6297.4 [Search PubMed] | cytochrome c oxidase assembly protein Cox11, putative (AFU_orthologue; AFUA_2G12260) |
| AN6296.4 [Search PubMed] | integral membrane protein (AFU_orthologue; AFUA_2G12300) |
| AN6295.4 [Search PubMed] | putative bHLH transcription factor (Eurofung); Comment: Heinekamp: putative bHLH transcription factor; identical gene models for A. fumigatus Afu2g12310, A. oryzae AO090026000419, A. terreus ATEG_01164; |
| AN6294.4 [Search PubMed] | conserved hypothetical protein |
| AN6293.4 [Search PubMed] | |
| AN6292.4 [Search PubMed] | conserved hypothetical protein |
| AN6291.4 [Search PubMed] | WD repeat protein (AFU_orthologue; AFUA_2G12360) |
| AN6290.4 [Search PubMed] | mitochondrion organization and biogenesis protein, putative (AFU_orthologue; AFUA_2G12370) |
| AN6289.4 [Search PubMed] | intracellular protein transport protein (Sat1), putative (AFU_orthologue; AFUA_2G12380) |
| AN6288.4 [Search PubMed] | protein kinase regulator (Mob1), putative (AFU_orthologue; AFUA_2G12390); Comment: Clutterbuck: gene symbol mobA (anmob1) |
| AN6287.4 [Search PubMed] | ATP synthase oligomycin sensitivity conferral protein, putative (AFU_orthologue; AFUA_2G12400) |
| AN6286.4 [Search PubMed] | conserved hypothetical protein |
| AN6285.4 [Search PubMed] | hypothetical protein |
| AN6284.4 [Search PubMed] | hypothetical protein |
| AN6283.4 [Search PubMed] | diphthamide biosynthesis protein, putative (AFU_orthologue; AFUA_2G12440) |
| AN10797.4 [Search PubMed] | hydroxymethylglutaryl-CoA lyase (AFU_orthologue; AFUA_2G12450) |
| AN10804.4 [Search PubMed] | Golgi integral membrane protein (Cln3), putative (AFU_orthologue; AFUA_2G12480) |
| AN10805.4 [Search PubMed] | lipase, putative (AFU_orthologue; AFUA_2G12490) |
| AN6281.4 [Search PubMed] | conserved hypothetical protein |
| AN6280.4 [Search PubMed] | conserved hypothetical protein |
| AN6279.4 [Search PubMed] | hypothetical protein similar to carnitine acetyl transferase (Eurofung); Comment: Flipphi Putative fatty acid-inducible, peroxisomal/mitochondrial carnitine acetyl transferase isozyme. PMID: 3622 (isolation of acuJ mutants) PMID: 8472927 (characteristics acuJ mutants) PMID: 9385142 (characteristics acuJ mutants) PMID: 9829933 (characteristics acuJ mutants) |
| AN6278.4 [Search PubMed] | hypothetical protein |
| AN6277.4 [Search PubMed] | MFS multidrug transporter, putative (AFU_orthologue; AFUA_2G12550) |
| AN6276.4 [Search PubMed] | pterin-4-alpha-carbinolamine dehydratase family protein (AFU_orthologue; AFUA_2G12560) |
| AN6275.4 [Search PubMed] | peptidase family M20/M25/M40 protein (AFU_orthologue; AFUA_2G12570) |
| AN6274.4 [Search PubMed] | short chain dehydrogenase/reductase family (AFU_orthologue; AFUA_7G04540) |
| AN6273.4 [Search PubMed] | allergenic cerato-platanin Asp F13 (AFU_orthologue; AFUA_2G12630) |
| AN6272.4 [Search PubMed] | NADPH-adrenodoxin reductase Arh1, putative (AFU_orthologue; AFUA_2G12610) |
| AN6271.4 [Search PubMed] | conserved hypothetical protein |
| AN6270.4 [Search PubMed] | Lectin C-type domain protein (AFU_orthologue; AFUA_2G12590) |
| AN6269.4 [Search PubMed] | translocation protein sec62 (Eurofung); Comment: gene product name updated- Ian Paulsen Archer: likely SEC62 (translocon component) into the ER. |
| AN6268.4 [Search PubMed] | DUF726 domain protein (AFU_orthologue; AFUA_2G12860) |
| AN6267.4 [Search PubMed] | vesicular-fusion protein sec17 (AFU_orthologue; AFUA_2G12870) |
| AN6266.4 [Search PubMed] | pre-rRNA processing protein Tsr1, putative (AFU_orthologue; AFUA_2G12880) |
| AN6265.4 [Search PubMed] | small nucleolar ribonucleoprotein complex subunit, putative (AFU_orthologue; AFUA_2G12890) |
| AN6264.4 [Search PubMed] | hypothetical protein similar to PTAB (Eurofung); Comment: Clutterbuck: ptaB is symbol for breakpoint of inversion2(I)-areB405-ptaB, leading to activation of areB. |
| AN6263.4 [Search PubMed] | mitochondrial AAA ATPase, putative (AFU_orthologue; AFUA_2G12920) |
| AN6262.4 [Search PubMed] | conserved hypothetical protein |
| AN6261.4 [Search PubMed] | conserved hypothetical protein; Comment: Pocsi, Miskei, Karanyi: Orthologue of S.pombe:Mus7 involved in double-strand break repair via homoloDNA synthesis during DNA repair, double-strand break repair, product name: DNA repair protein |
| AN10802.4 [Search PubMed] | conserved hypothetical protein |
| AN6260.4 [Search PubMed] | PAPA-1-like conserved region protein (AFU_orthologue; AFUA_2G12960) |
| AN6259.4 [Search PubMed] | conserved hypothetical protein |
| AN6258.4 [Search PubMed] | putative microbody (peroxisome) biogenesis protein peroxin 14/17 (Eurofung); Comment: Kiel: Pex14p N-terminal conserved region containing protein GI:40739452 |
| AN6257.4 [Search PubMed] | vesicle coat complex COPII, subunit SEC31, putative (Eurofung); Comment: T. Pakula: homol. to Protein WEB1 (Protein transport protein SEC31). SP:P38968: Protein WEB1 (Protein transport protein SEC31). {Saccharomyces cerevisiae;} (exp=-1; wgp=-1; cg=-1; genomes=-1; )^|^RF|NP_010086.1|6320006|NC_001136 Essential phosphoprotein component (p150) of the COPII coat of secretory pathway vesicles, in complex with Sec13p; required for ER-derived transport vesicle formation {Saccharomyces cerevisiae;} (exp=1; wgp=0; cg=1; genomes=0; )^|^GB|CAA98772.1|1431320|SCYDL195W ORF YDL195w {Saccharomyces cerevisiae;} (exp=-1; wgp=0; cg=-1; genomes=0; )^|^GB|CAA58252.1|1004300|SCDNAIV putative ORF {Saccharomyces cerevisiae;} (exp=-1; wgp=0; cg=-1; genomes=0; ) |
| AN6256.4 [Search PubMed] | peptidyl prolyl cis-trans isomerase Cyclophilin, putative (AFU_orthologue; AFUA_2G12990) |
| AN10803.4 [Search PubMed] | conserved hypothetical protein |
| AN6255.4 [Search PubMed] | cytochrome c oxidase polypeptide vib (AFU_orthologue; AFUA_2G13010) |
| AN6254.4 [Search PubMed] | hypothetical protein similar to mitochondrial dicarboxylate transporter (Eurofung); Comment: Flipphi Catalyses a dicarboxylate-phosphate exchange across the inner mitochondrial membrane, and transports cytoplasmic dicarboxylates (like malate and succinate) into the matrix. In yeast, it is required for growth on acetate. AN6254 is one of several carrier proteins (including AN1917, next to acuF) with similarity to S. cerevisiae Dic1p. In A.nidulans, no mutations in acetate catabolism are known that align with the locus AN6254. Hypothetical protein similar (Expect = 1e-49; Identities 49%, Positives 63%) to the functional dicarboxylate transporter from S. cerevisiae, Dic1p. sp|Q06143|74655010|DIC1_YEAST Mitochondrial dicarboxylate transporter (Dicarboxylate carrier 1)(DTP) PMID: 9020177 (yeast DIC1 gene identification and functionality) PMID: 8831951 (characterisation yeast dicarboxylate carrier) PMID: 10027973 (acetate phenotype in yeast) PMID: 15591051 (association with yeast mitochondrial inner membrane) |
| AN6253.4 [Search PubMed] | phenylalanyl-tRNA synthetase alpha subunit putative (Eurofung); Comment: turner: ts mutant polarity defective PMID 11273680 GB:AAF79201.1: phenylalanyl-tRNA synthetase alpha subunit-like protein {Emericella nidulans;} |
| AN6252.4 [Search PubMed] | RNA polymerase II subunit 3 (AFU_orthologue; AFUA_2G13090); Comment: similar to SP|P16370|RPB3_YEAST DNA-directed RNA polymerase II 45 kDa polypeptide [Saccharomyces cerevisiae] matches PF01000: DNA-directed RNA polymerase, alpha subunit, N terminal domain matches PS00446: RNA polymerases D / 30 to 40 Kd subunits signature. |
| AN6251.4 [Search PubMed] | Nudix/MutT family protein (AFU_orthologue; AFUA_2G13080) |
| AN6250.4 [Search PubMed] | arginine-tRNA-protein transferase 1 (AFU_orthologue; AFUA_2G13070) |
| AN6249.4 [Search PubMed] | calcineurin binding protein, putative (AFU_orthologue; AFUA_2G13060) |
| AN11506.4 [Search PubMed] | hypothetical protein |
| AN6248.4 [Search PubMed] | mitochondrial co-chaperone GrpE, putative (AFU_orthologue; AFUA_2G13040) |
| AN6247.4 [Search PubMed] | conserved hypothetical protein |
| AN6246.4 [Search PubMed] | cytochrome c (Eurofung); Comment: identical to SP:P38091: Cytochrome c. [Aspergillus nidulans] {Emericella nidulans} PMID: 8277943 |
| AN6245.4 [Search PubMed] | conserved hypothetical protein |
| AN6244.4 [Search PubMed] | 3' exoribonuclease family protein (Rrp42), putative (AFU_orthologue; AFUA_2G13130) |
| AN11505.4 [Search PubMed] | hypothetical protein |
| AN6243.4 [Search PubMed] | Serine/threonine protein kinase ime2 homologue imeB (Eurofung); Comment: Takeshita: Serine/threonine protein kinase ime2 homologue imeB RF:XP_663847.1: hypothetical protein {Aspergillus nidulans FGSC A4;} (exp=-1; wgp=0; cg=1; genomes=0; ) |
| AN6242.4 [Search PubMed] | conserved hypothetical protein |
| AN6241.4 [Search PubMed] | hypothetical protein |
| AN6240.4 [Search PubMed] | OB-fold nucleic acid binding domain (AFU_orthologue; AFUA_2G13170) |
| AN6239.4 [Search PubMed] | siderophore biosynthesis lipase/esterase, putative (AFU_orthologue; AFUA_3G03390) |
| AN6238.4 [Search PubMed] | MFS siderophore iron transporter, putative (AFU_orthologue; AFUA_3G03440) |
| AN6237.4 [Search PubMed] | ABC multidrug transporter (Eurofung); Comment: gene product name updated- Ian Paulsen |
| AN6236.4 [Search PubMed] | putative siderophore synthetase (Eurofung); Comment: conserved putative fusarinine type siderophore biosynthesis cluster of NRPS (AN6238), ABC-transporter (AN6237) and putative siderophore transporter (AN6236) also in [Aspergillus fumigatus, Aspergillus oryzae, Aspergillus terreus, Aspergillus clavatus and Neosartorya fischeri]. Expression of SidD in A. fumigatus is iron-dependent, PMID: 15953695. Similarity to NPS6 [Cochliobolus heterostrophus] protecting against oxidative stress, PMID: 15755917. Similar synthetases in [Botryotina fuckeliana and Chaetomium globosum]. |
| AN10814.4 [Search PubMed] | conserved hypothetical protein |
| AN10821.4 [Search PubMed] | conserved hypothetical protein |
| AN6485.4 [Search PubMed] | cytochrome P450, putative (Eurofung); Comment: Krasevec & Kelly: ok |
| AN6484.4 [Search PubMed] | hypothetical protein |
| AN10813.4 [Search PubMed] | conserved hypothetical protein |
| AN10820.4 [Search PubMed] | conserved hypothetical protein |
| AN6482.4 [Search PubMed] | conserved hypothetical protein |
| AN6481.4 [Search PubMed] | conserved hypothetical protein |
| AN6480.4 [Search PubMed] | conserved hypothetical protein |
| AN6479.4 [Search PubMed] | conserved hypothetical protein |
| AN6478.4 [Search PubMed] | conserved hypothetical protein |
| AN11518.4 [Search PubMed] | hypothetical protein |
| AN6477.4 [Search PubMed] | MFS multidrug transporter, putative (AFU_orthologue; AFUA_1G01930) |
| AN11517.4 [Search PubMed] | hypothetical protein |
| AN6476.4 [Search PubMed] | conserved hypothetical protein |
| AN11516.4 [Search PubMed] | hypothetical protein |
| AN6475.4 [Search PubMed] | hypothetical protein; Comment: Clutterbuck:2003 nt 3` overlap with heavily RIP-affected DNA-3 (MATE) element (Kapitonov & Jurka 2003 RepBase reports 3; 205 ) co-ordinates 318267-3119689 |
| AN6474.4 [Search PubMed] | hypothetical protein; Comment: Clutterbuck: in heavily RIP-affected DNA-3 (MATE) element (Kapitonov & Jurka 2003 RepBase reports 3; 205 ) co-ordinates 318267-3119689 |
| AN11515.4 [Search PubMed] | hypothetical protein; Comment: Clutterbuck: in heavily RIP-affected DNA-3 (MATE) element (Kapitonov & Jurka 2003 RepBase reports 3; 205 ) co-ordinates 318267-3119689 |
| AN6473.4 [Search PubMed] | conserved hypothetical protein |
| AN6472.4 [Search PubMed] | putative endo mannanase, GH76 family (Eurofung); Comment: De Groot: putative endo-mannanase (GH76-family) with a possible role in GPI-CWP incorporation. ScDfg5-like. Has a signal peptide, but no TM-domain or a GPI addition signal |
| AN6471.4 [Search PubMed] | hypothetical protein; Comment: Piet de Groot: GPI-anchored protein according to BIG-PI Fungal Predictor |
| AN6470.4 [Search PubMed] | N,O-diacetyl muramidase, putative (AFU_orthologue; AFUA_6G10130) |
| AN11514.4 [Search PubMed] | hypothetical protein |
| AN11513.4 [Search PubMed] | hypothetical protein |
| AN6469.4 [Search PubMed] | conserved hypothetical protein; Comment: Clutterbuck: 100 nt 5` overlap with copia-5_AN_LTR and LTR-5_AN spans from exon1-exon2 (Kapitonov & Jurka 2003 RepBase reports 3; 217. Cluterbuck unpublished ) co-ordinates 282894-293033 and 294039-293758 |
| AN6468.4 [Search PubMed] | conserved hypothetical protein |
| AN10812.4 [Search PubMed] | conserved hypothetical protein |
| AN10819.4 [Search PubMed] | conserved hypothetical protein |
| AN10815.4 [Search PubMed] | conserved hypothetical protein |
| AN10811.4 [Search PubMed] | cytochrome P450, putative (Eurofung); Comment: Krasevec & Kelly: ok |
| AN6465.4 [Search PubMed] | hypothetical protein |
| AN6464.4 [Search PubMed] | esterase, putative (AFU_orthologue; AFUA_1G03170) |
| AN11512.4 [Search PubMed] | hypothetical protein |
| AN11511.4 [Search PubMed] | hypothetical protein |
| AN6463.4 [Search PubMed] | conserved hypothetical protein |
| AN11510.4 [Search PubMed] | hypothetical protein |
| AN6462.4 [Search PubMed] | amidohydrolase, putative (AFU_orthologue; AFUA_6G11660) |
| AN6461.4 [Search PubMed] | conserved hypothetical protein |
| AN6460.4 [Search PubMed] | conserved hypothetical protein |
| AN6459.4 [Search PubMed] | isoamyl alcohol oxidase (AFU_orthologue; AFUA_3G07410) |
| AN6458.4 [Search PubMed] | hypothetical protein |
| AN6457.4 [Search PubMed] | conserved hypothetical protein |
| AN6456.4 [Search PubMed] | conserved hypothetical protein |
| AN6455.4 [Search PubMed] | conserved hypothetical protein; Comment: Piet de Groot: GPI-protein according to BIG-PI Fungal Predictor |
| AN6454.4 [Search PubMed] | conserved hypothetical protein |
| AN6453.4 [Search PubMed] | TfdA family oxidoreductase, putative (AFU_orthologue; AFUA_4G13850) |
| AN6452.4 [Search PubMed] | OPT peptide transporter Mtd1, putative (AFU_orthologue; AFUA_7G00910) |
| AN6451.4 [Search PubMed] | conserved hypothetical protein |
| AN6450.4 [Search PubMed] | oxidoreductase, short-chain dehydrogenase/reductase family, putative (AFU_orthologue; AFUA_5G01040) |
| AN6449.4 [Search PubMed] | cytochrome P450, putative (Eurofung); Comment: Krasevec & Kelly: CYP5077A1 OLD NAME = CYP532E1 5' to long - wrong splicing of the first intron and one exon + intron less; 488 aa MAILVRLFFALFVVSVYFFRVRLRLSHIPGPFLASLTNINRRQWVTTGRAHTIHTELHRQYGKVVRAGPNTVFVSDPAAIPAIYRFNEPYQKSEFYDALMPYVRGKSIPDVFATRDEHIHRTMKQPI AAIYSMSNLVSFEPYVKSTIEYFFSRLDSLFVETGKVCNFGLWLHLFASDVMGEITFSRRLGFLETGGDMENVMANNWKFFVQAAPATQMPWLDYFWKRNPLLPGSVKPNKVIEFGVARIQERLHLS EKHPDHVNSRDFLSRFIAAKEKNSQIGPDAIMTWANSNIQAGSDTTAILLSALFYHLLKNPTSLAALCTEIDAAAKRGCLSSILTWKETRDLPYLDACVKEAARLHPPISLPLERVIPESGTVIGGF KIPGGTRVAMNPWAVHRDRDVFGADADTWRPERWLEGEEKAKTLYNSLLTFGGGHRSCLGKNISYLEIYKLVPSILLRPLCRLRLLLPRTPAPEPHPWPVPRFSDKH |
| AN6448.4 [Search PubMed] | polyketide synthase, putative (JCVI) |
| AN6447.4 [Search PubMed] | O-methyltransferase, putative (AFU_orthologue; AFUA_4G14580) |
| AN11509.4 [Search PubMed] | hypothetical protein |
| AN6446.4 [Search PubMed] | putative Myb-like transcription factor (Eurofung); Comment: Heinekamp: putative Myb-like transcription factor; |
| AN6445.4 [Search PubMed] | GMC oxidoreductase, putative (AFU_orthologue; AFUA_3G08070) |
| AN6444.4 [Search PubMed] | NRPS-like enzyme, putative (JCVI) |
| AN6443.4 [Search PubMed] | ABC multidrug transporter (Eurofung); Comment: gene product name updated- Ian Paulsen |
| AN6442.4 [Search PubMed] | amino acid transporter (Eurofung); Comment: Gene product name updated- Ian Paulsen |
| AN10817.4 [Search PubMed] | hypothetical protein |
| AN6441.4 [Search PubMed] | conserved hypothetical protein |
| AN6440.4 [Search PubMed] | conserved hypothetical protein |
| AN6439.4 [Search PubMed] | conserved hypothetical protein |
| AN6438.4 [Search PubMed] | hypothetical dipeptidyl aminopeptidase (Eurofung); Comment: GB:BAE59130.1: unnamed protein product; dipeptidyl aminopeptidase {Aspergillus oryzae;} (exp=-1; wgp=1; cg=-1; genomes=0; ) M Jones |
| AN11508.4 [Search PubMed] | hypothetical protein |
| AN6437.4 [Search PubMed] | conserved hypothetical protein |
| AN6436.4 [Search PubMed] | ABC multidrug transporter (Eurofung); Comment: gene product name updated- Ian Paulsen |
| AN6435.4 [Search PubMed] | conserved hypothetical protein |
| AN6434.4 [Search PubMed] | cytochrome P450, putative (Eurofung); Comment: Krasevec & Kelly: ok |
| AN6433.4 [Search PubMed] | Diacylglycerol acyltransferase family (AFU_orthologue; AFUA_4G14150) |
| AN10816.4 [Search PubMed] | hypothetical protein |
| AN6432.4 [Search PubMed] | conserved hypothetical protein |
| AN6431.4 [Search PubMed] | polyketide synthase, putative (JCVI); Comment: Similar to Fum5p; polyketide synthase (GI:5453383) {Gibberella moniliformis} PMID:10413619. |
| AN6430.4 [Search PubMed] | Putative Zn(II)2Cys6 transcription factor (Eurofung); Comment: Manually curated A.F.J Ram and P.J. Punt |
| AN6429.4 [Search PubMed] | conserved hypothetical protein |
| AN6428.4 [Search PubMed] | conserved hypothetical protein; Comment: R.P.de Vries: unknown function CAZY family gh61 |
| AN6427.4 [Search PubMed] | beta-1,4-endomannanase (Eurofung); Comment: R.P.de Vries: function based on activity CAZY family gh5 |
| AN6426.4 [Search PubMed] | conserved hypothetical protein |
| AN6425.4 [Search PubMed] | hypothetical protein |
| AN10818.4 [Search PubMed] | hypothetical protein |
| AN6424.4 [Search PubMed] | conserved hypothetical protein |
| AN6423.4 [Search PubMed] | conserved hypothetical protein |
| AN6422.4 [Search PubMed] | cellulose-binding GDSL lipase/acylhydrolase, putative (AFU_orthologue; AFUA_2G00510) |
| AN6421.4 [Search PubMed] | urea hydro-lyase/cyanamide hydratase, putative (AFU_orthologue; AFUA_1G10870) |
| AN6420.4 [Search PubMed] | pirin domain protein, putative (AFU_orthologue; AFUA_2G01100) |
| AN6419.4 [Search PubMed] | conserved hypothetical protein |
| AN6418.4 [Search PubMed] | MFS transporter, putative (AFU_orthologue; AFUA_2G17840) |
| AN6417.4 [Search PubMed] | MFS transporter, putative (AFU_orthologue; AFUA_5G00430) |
| AN6416.4 [Search PubMed] | conserved hypothetical protein |
| AN6415.4 [Search PubMed] | conserved hypothetical protein |
| AN6414.4 [Search PubMed] | cytochrome P450, putative (Eurofung); Comment: Krasevec & Kelly: 3' to long - no splicing of intron; 506 aa MIKSLPAAGTLSCLVRMMERSWKYIAIACALWVVQKIYSAITSPLRAIPGPFYTSLTRLPLKLSIIAGQRIYFIHSLHQRYGPIVRVSPTEVSIASLPEFREIHRVGSPFLKSNWYEKFVMGQHSPG VFAISDPKQHGARRRLFARAMSNTELRRVWEDVVRSKVRLAVDRIKGELEADGARCDVLKWWTFLATDVVGHLMFGEDFDMLNIGVKNEYIHVLESTMKGSGINAELPLVGCIGRHLPFSVVRSMFR ANDYLTNYGKRAVTNARAKSDSSRNIFSGMLYEAEKCTDSDSGLSELDIITEAGNMIVAGSDTTAVTLTYLVWVVLSRPQLQREIESEVLALEEGYDDAKLETLPVLNAVIKETLRLYGAAPGSLPR TVPRGGATLGGYFIPEGMTVSTQSWTVHRDENLFPDPDSFNISRWLEENDAGFPAAQLAFSPFGAGGRICLGIHLAYMELRLAAAEFFRRCRGVRLSPDTTWKIMKPMNYFLIAPTGNRCDIMRG |
| AN6413.4 [Search PubMed] | integral membrane protein (AFU_orthologue; AFUA_4G00600) |
| AN6412.4 [Search PubMed] | MFS multidrug transporter, putative (AFU_orthologue; AFUA_2G00780) |
| AN6411.4 [Search PubMed] | GNAT family N-acetyltransferase, putative (AFU_orthologue; AFUA_3G00870) |
| AN6410.4 [Search PubMed] | conserved hypothetical protein |
| AN6409.4 [Search PubMed] | conserved hypothetical protein |
| AN6408.4 [Search PubMed] | conserved hypothetical protein |
| AN6407.4 [Search PubMed] | cytochrome P450, putative (Eurofung); Comment: Krasevec & Kelly: 5' to short - two exons and two introns more; 509 aa MDFLMEYGSPAGFFTIFATLWLVYCLLRMLYNVSPLHPLSHIPGPNLAAATFLYESWFDLVLGGKYTHKIKRMHEQYGPVVRINPEELHFNDISFANEIYAGPGRKRNKQVHYLNIFAGPTTSSMLA TVEHGHHRVRRSAVNRFFSRAQISKLESNIKDLALGLCDKMIRLAYSCFSGDVISKYCFGEPFGFIAQEEWEPNYRNALKATQAPVHVFRTFPFLKRLTDIAPLCARWASPGIREMLIESNEKMPAR IRKARQDSKRGITETQPSLFAALLDAPLPEAEKTDQRLGGEGFLMIAAGTETTAWTLTVITFHLLNQPDTLNRLRCELQDADALNLQWFALERLPYLTAVIHEGLRLSYGVSQRISRIAPTETLVYQ GEHNGRRIEYSIPSGTTMGMSNAINHHNEDAFPDSDAFIPERWINIDDAQRRRMDSCLTPFSKGSRQCLGINLAYCNLYLALTALTLRVLPWMSLYETTVDDVRYHSDLFAPLPKKGTKGVRAIISY P |
| AN6406.4 [Search PubMed] | conserved hypothetical protein |
| AN6405.4 [Search PubMed] | secreted glycosyl hydrolase, putative (AFU_orthologue; AFUA_4G14420) |
| AN6404.4 [Search PubMed] | conserved hypothetical protein |
| AN6403.4 [Search PubMed] | conserved hypothetical protein |
| AN6402.4 [Search PubMed] | conserved hypothetical protein |
| AN6401.4 [Search PubMed] | conserved hypothetical protein; Comment: Piet de Groot: Putative hydrophobin because of its conserved cysteine pattern |
| AN6400.4 [Search PubMed] | FRE family ferric-chelate reductase, putative (AFU_orthologue; AFUA_1G17270) |
| AN6399.4 [Search PubMed] | conserved hypothetical protein |
| AN6398.4 [Search PubMed] | UDP-galactose 4-epimerase, putative (AFU_orthologue; AFUA_7G00360) |
| AN6397.4 [Search PubMed] | conserved hypothetical protein |
| AN6396.4 [Search PubMed] | Putative Zn(II)2Cys6 transcription factor (Eurofung); Comment: Afu orthologue: AFUA_8G04540 |
| AN6395.4 [Search PubMed] | rhamnogalacturonan lyase (Eurofung); Comment: R.P.de Vries: function based on activity CAZY family pl4 |
| AN6394.4 [Search PubMed] | acyl-CoA dehydrogenase family protein (AFU_orthologue; AFUA_6G10880) |
| AN6393.4 [Search PubMed] | conserved hypothetical protein |
| AN6392.4 [Search PubMed] | Putative Zn(II)2Cys6 transcription factor (Eurofung) |
| AN6391.4 [Search PubMed] | serine/threonine protein phosphatase PP2A catalytic subunit (Eurofung); Comment: Clutterbuck: pphA: type 2A protein phosphatase: AJ291510; GI:10880267; PMID:11318104: mutant had defective growth and mitosis. |
| AN6390.4 [Search PubMed] | homogentisate 1,2-dioxygenase, putative (AFU_orthologue; AFUA_6G10810) |
| AN6389.4 [Search PubMed] | carboxylesterase, putative (AFU_orthologue; AFUA_6G10800) |
| AN6388.4 [Search PubMed] | beta-galactosidase (Eurofung); Comment: R.P. de Vries: function based on sequence similarity. CAZY family GH2. |
| AN6387.4 [Search PubMed] | MFS amine transporter, putative (AFU_orthologue; AFUA_6G10790) |
| AN6386.4 [Search PubMed] | mitochondrial NADH-cytochrome b5 reductase (Eurofung); Comment: Pocsi, Miskei, Karanyi: Orthologue of C.albicans:MCR1, S.cerevisiae:MCR1 involved in response to oxidative stress, product name: Mitochondrial NADH-cytochrome b5 reductase , EC number: 1.6.2.2 |
| AN6385.4 [Search PubMed] | transcriptional corepressor (Eurofung); Comment: Pocsi, Miskei, Karanyi: Orthologue of S.pombe:Tup12 involved in chromatin remodeling in response to cation stress, response to cation stress, product name: Transcriptional corepressor |
| AN6384.4 [Search PubMed] | conserved hypothetical protein |
| AN6383.4 [Search PubMed] | carboxylesterase, putative (AFU_orthologue; AFUA_6G10780) |
| AN6382.4 [Search PubMed] | conserved hypothetical protein |
| AN11519.4 [Search PubMed] | hypothetical protein; Comment: Clutterbuck: hAT-N1_AN in intron1 (Kapitonov & Jurka 2003 RepBase reports 3; 218 ) co-ordinates 4987-5272 |
| AN10829.4 [Search PubMed] | hypothetical protein |
| AN6487.4 [Search PubMed] | aspartic-type endopeptidase (OpsB), putative (AFU_orthologue; AFUA_6G05350) |
| AN6488.4 [Search PubMed] | tryptophanyl-tRNA synthetase, putative (AFU_orthologue; AFUA_6G05340) |
| AN6489.4 [Search PubMed] | 37 ribosomal protein Rsm10, putative (AFU_orthologue; AFUA_6G05330) |
| AN6490.4 [Search PubMed] | purine nucleoside phosphorylase I, inosine and guanosine-specific (AFU_orthologue; AFUA_6G05320); Comment: similar to Purine nucleoside phosphorylase (EC 2.4.2.1) (Inosine phosphorylase) (PNP) (SP:P55859) [Bovine] {Bos taurus}. |
| AN6491.4 [Search PubMed] | nucleolus protein required for cell viability, putative (AFU_orthologue; AFUA_6G05310) |
| AN6492.4 [Search PubMed] | CCAAT transcription factor subunit HapE (Eurofung); Comment: Heinekamp,T. : CCAAT binding factors (CBFs) positively regulating the expression of the amdS gene (encoding acetamidase) and two penicillin biosynthesis genes (ipnA and aatA) AnCF consists of the HapB, HapC and HapE subunits. All three subunits are necessary for DNA binding. |
| AN6493.4 [Search PubMed] | Exocyst complex component Sec15, putative (Eurofung); Comment: Homol. to exocyst complex component SEC15 of S. cerevisiae and Aspergilli(Tiina Pakula) |
| AN6494.4 [Search PubMed] | conserved hypothetical protein, mei2 homologue meiB (Eurofung); Comment: Takeshita: mei2 homologue meiB RF:XP_664098.1: hypothetical protein {Aspergillus nidulans FGSC A4;} (exp=-1; wgp=0; cg=1; genomes=0; ) |
| AN6495.4 [Search PubMed] | conserved hypothetical protein |
| AN6496.4 [Search PubMed] | transferase (Gpi7), putative (AFU_orthologue; AFUA_6G05260) |
| AN6497.4 [Search PubMed] | conserved hypothetical protein |
| AN10822.4 [Search PubMed] | SUMO ligase SizA, putative (AFU_orthologue; AFUA_6G05240) |
| AN10826.4 [Search PubMed] | transport protein particle (TRAPP) complex subunit TRS33, putative (Eurofung); Comment: Tiina Pakula: Homol to TRAPP complex subunit TRS33 (S. cerevisiae)/TRAPP subunit 6B SP:Q9D289: Trafficking protein particle complex subunit 6B. {Mus musculus;} (exp=-1; wgp=-1; cg=-1; genomes=-1; )^|^RF|NP_084333.1|58037519|NM_030057 trafficking protein particle complex 6B {Mus musculus;} (exp=-1; wgp=0; cg=1; genomes=0; )^|^GB|AAH31464.1|21618688|BC031464 trafficking protein particle complex 6B {Mus musculus;} (exp=-1; wgp=0; cg=-1; genomes=0; ) SP:Q99394: Transport protein particle 33 kDa subunit (TRAPP 33 kDa subunit). {Saccharomyces cerevisiae;} (exp=-1; wgp=-1; cg=-1; genomes=-1; )^|^RF|NP_014758.1|6324689|NC_001147 One of 10 subunits of the transport protein particle (TRAPP) complex of the cis-Golgi which mediates vesicle docking and fusion; involved in endoplasmic reticulum (ER) to Golgi membrane traffic {Saccharomyces cerevisiae;} (exp=1; wgp=0; cg=1; genomes=0; )^|^GB|CAA99313.1|1420307|SCYOR115C unnamed protein product; ORF YOR115c {Saccharomyces cerevisiae;} (exp=-1; |
| AN6499.4 [Search PubMed] | malate dehydrogenase, NAD-dependent (AFU_orthologue; AFUA_6G05210); Comment: similar to malate dehydrogenase (GI:19702487) {Talaromyces emersonii} contains non-canonical donor splice site for second intron. Clutterbuck: mdhC: similar to peroxisomal malate dehdrogenase: PMID:15449589 |
| AN6500.4 [Search PubMed] | 60S ribosomal protein L28 (AFU_orthologue; AFUA_6G05200) |
| AN10827.4 [Search PubMed] | hypothetical protein |
| AN6501.4 [Search PubMed] | splicing factor 3b subunit 4 (AFU_orthologue; AFUA_6G05180) |
| AN10828.4 [Search PubMed] | TOM complex component Tom7, putative (AFU_orthologue; AFUA_6G05174) |
| AN10823.4 [Search PubMed] | mitochondrial folate carrier protein Flx1, putative (AFU_orthologue; AFUA_6G05170) |
| AN6503.4 [Search PubMed] | C2H2 transcription factor (Azf1), putative (AFU_orthologue; AFUA_6G05160) |
| AN6504.4 [Search PubMed] | hypothetical protein |
| AN6505.4 [Search PubMed] | transcriptional corepressor (Eurofung); Comment: Clutterbuck: rcoA, tupA: Saccharomyces cerevisiae Tup1p, Neurospora crassa RCO1 WD40 repeat protein homologue. Required for full expression of brlA and aflR: PMID11260466; AF197225, GI:11066216 Also required for sexual reproduction: PMID:16980390 Comparisons using Sybil and the sequence preceding the ATG suggest that position 52263 is a more likely start point. The third intron does not correspond with other Aspergilli, and had unusual start and end points, but no alternative structure is obvious. Pocsi, Miskei, Karanyi: Orthologue of N.crassa:RCO-1, S.pombe:Tup12 involved in chromatin remodeling in response to cation stress, response to cation stress, product name: Transcriptional corepressor |
| AN6506.4 [Search PubMed] | sterol delta 5,6-desaturase ERG3 (AFU_orthologue; AFUA_6G05140) |
| AN6507.4 [Search PubMed] | snRNA cap binding complex subunit (Gcr3), putative (AFU_orthologue; AFUA_6G05130) |
| AN6508.4 [Search PubMed] | hypothetical protein similar to glycogen synthase kinase-3 (Eurofung); Comment: Pocsi, Miskei, Karanyi: Orthologue of S.cerevisiae:RIM11 involved in response to stress, product name: Protein kinase , EC number: 2.7.1.- |
| AN11520.4 [Search PubMed] | hypothetical protein |
| AN6509.4 [Search PubMed] | hypothetical protein |
| AN6510.4 [Search PubMed] | mitochondrial import receptor subunit (tom40), putative (AFU_orthologue; AFUA_6G05110) |
| AN10824.4 [Search PubMed] | 6-phosphofructo-2-kinase, putative (AFU_orthologue; AFUA_6G05100) |
| AN10832.4 [Search PubMed] | RNA polymerase II Elongator subunit, putative (AFU_orthologue; AFUA_6G05090) |
| AN6512.4 [Search PubMed] | ABC transporter (Eurofung); Comment: gene product name updated- Ian Paulsen |
| AN6513.4 [Search PubMed] | tRNA isopentenyltransferase, putative (AFU_orthologue; AFUA_6G05070) |
| AN6514.4 [Search PubMed] | Dhp1-interacting protein Din1, putative (AFU_orthologue; AFUA_6G05060) |
| AN6515.4 [Search PubMed] | DUF410 domain protein (AFU_orthologue; AFUA_6G05050) |
| AN6516.4 [Search PubMed] | hypothetical protein |
| AN6517.4 [Search PubMed] | subunit of heteropentameric replication factor (Eurofung); Comment: Pocsi, Miskei, Karanyi: Orthologue of C.albicans:RFC4, S.cerevisiae:RFC4 involved in mismatch repair, product name: Subunit of heteropentameric replication factor, EC number: 2.7.7.7 |
| AN6518.4 [Search PubMed] | polysaccharide deacetylase family protein (AFU_orthologue; AFUA_6G05030) |
| AN10833.4 [Search PubMed] | amidase (Eurofung); Comment: PMID 17107606 M Jones |
| AN10825.4 [Search PubMed] | amino acid transporter, putative (AFU_orthologue; AFUA_6G04990) |
| AN6520.4 [Search PubMed] | cytochrome c mitochondrial import factor (Cyc2), putative (AFU_orthologue; AFUA_6G04980) |
| AN6521.4 [Search PubMed] | homoaconitase, mitochondrial precursor (Eurofung); Comment: Clutterbuck: lysF; lysine biosynthesis; homoaconitase, cloned X99624; PMID9268014, 11285740 |
| AN6522.4 [Search PubMed] | mitochondrial GTPase (Mss1), putative (AFU_orthologue; AFUA_6G04950) |
| AN6523.4 [Search PubMed] | cytokinesis protein sepA (Eurofung); Comment: similar to cytokinesis protein sepA; (SP:SP:P78621)[Emericella nidulans], PMID:9218790, PMID:11854405, PMID:10049919. similar to formin Bni1p (SP:P41832) [Saccharomyces cerevisiae] Pocsi, Miskei, Karanyi: Orthologue of C.albicans:BNI1, S.cerevisiae:BNI1 involved in response to osmotic stress, product name: Formin, nucleates the formation of linear actin filaments , EC number: 3.1.1.3 |
| AN6524.4 [Search PubMed] | conserved hypothetical protein |
| AN6525.4 [Search PubMed] | formate dehydrogenase (Eurofung); Comment: Clutterbuck: gene symbol, EC# |
| AN6526.4 [Search PubMed] | leucyl-tRNA synthetase (AFU_orthologue; AFUA_6G04910) |
| AN6527.4 [Search PubMed] | sucrase/ferredoxin-like family protein Fmi1, putative (AFU_orthologue; AFUA_6G04900) |
| AN6528.4 [Search PubMed] | hypothetical protein similar to TPA: CaaX protease (Eurofung); Comment: Clutterbuck: rce1: CaaX protease; mating factor C-terminal processing; BK001297; GI:34482028 PMID:12949156 |
| AN6529.4 [Search PubMed] | serine-rich protein, putative (AFU_orthologue; AFUA_6G04880) |
| AN6530.4 [Search PubMed] | MBOAT family protein, putative (AFU_orthologue; AFUA_6G04860) |
| AN6531.4 [Search PubMed] | hypothetical protein similar to VpsB (Eurofung); Comment: Clutterbuck: vpsB: AB074884: Sec1-like protein involved in vacuolar protein sorting and secretion. |
| AN6532.4 [Search PubMed] | short chain dehydrogenase/reductase family protein (AFU_orthologue; AFUA_6G04850) |
| AN6533.4 [Search PubMed] | hypercellular protein A (Eurofung); Comment: PMID:14643261. HypA. Orthologue of Saccharomyces cerevisiae TRAPP II subunit Trs120 required for intra-Golgi transport. Involved in endomembrane organization and secretion. PMID: 9504915. Mutant (hypA1) displays defects in maintenance of hyphal polarity and in hyphal patterning. PMID: 10049919. Another mutant (hypA6, also known as podA1) displays defects in polarized hyphal growth. entered by S. Harris (11/30/2006) |
| AN6534.4 [Search PubMed] | hypothetical protein similar to MIPC synthase (Eurofung); Comment: Clutterbuck: surA, sphingolipid biosynthesis, MIPC synthase: AF488724 |
| AN6535.4 [Search PubMed] | conserved hypothetical protein |
| AN6536.4 [Search PubMed] | hypothetical protein similar to imidazoleglycerol-phosphate dehydratase (Eurofung); Comment: Similar to: GI:13194524: imidazoleglycerol-phosphate dehydratase {Aspergillus nidulans} Helmstaedt: GB:AAK15457.1: imidazoleglycerol-phosphate dehydratase {Emericella nidulans;} RF:XP_664140.1: hypothetical protein {Aspergillus nidulans FGSC A4;} PMID: 5512357, 6363882, 11270573 deletion results in histidine auxotrophy and blocked sexual fruiting body formation |
| AN6537.4 [Search PubMed] | conserved hypothetical protein |
| AN6538.4 [Search PubMed] | conserved hypothetical protein |
| AN6539.4 [Search PubMed] | conserved hypothetical protein |
| AN6540.4 [Search PubMed] | mitochondrial mRNA processing protein PET127, putative (AFU_orthologue; AFUA_6G04720) |
| AN6541.4 [Search PubMed] | phosphoribosylamine-glycine ligase (Eurofung); Comment: Clutterbuck: adF; homology confirmed in A. niger and N. crassa |
| AN10831.4 [Search PubMed] | conserved hypothetical protein |
| AN6542.4 [Search PubMed] | actin (Eurofung); Comment: Clutterbuck: gene symbol Pocsi, Miskei, Karanyi: Orthologue of S.cerevisiae:ACT1 involved in response to osmotic stress, response to oxidative stress, DNA repair, product name: Actin, structural protein |
| AN10830.4 [Search PubMed] | hypothetical protein |
| AN6543.4 [Search PubMed] | Hsp70 nucleotide exchange factor (Fes1), putative (AFU_orthologue; AFUA_6G04750) |
| AN6544.4 [Search PubMed] | UPF0220 domain protein (AFU_orthologue; AFUA_6G04760) |
| AN6545.4 [Search PubMed] | conserved hypothetical protein |
| AN6546.4 [Search PubMed] | Vacuolar protein sorting 55 superfamily (AFU_orthologue; AFUA_6G04780) |
| AN6547.4 [Search PubMed] | proteasome component Pre5, putative (AFU_orthologue; AFUA_6G04790) |
| AN6548.4 [Search PubMed] | lysine decarboxylase-like protein (AFU_orthologue; AFUA_6G04800) |
| AN6549.4 [Search PubMed] | RNA polymerase II transcription mediator complex subunit (Med6), putative (AFU_orthologue; AFUA_6G04810) |
| AN6550.4 [Search PubMed] | para aminobenzoic acid synthetase (Eurofung); Comment: Clutterbuck: homology confirmed in A. niger and A. fumigatus: pabaA |
| AN6551.4 [Search PubMed] | HATPase_c domain protein, putative (AFU_orthologue; AFUA_6G04830) |
| AN6552.4 [Search PubMed] | conserved hypothetical protein |
| AN6553.4 [Search PubMed] | hypothetical protein |
| AN6554.4 [Search PubMed] | hypothetical protein similar to histone H3 (Broad); Comment: similar to inner centromere protein; histone H3 variant; essential; required for equal chromosome segregation; similar to S. cerevisiae CSE4 (GI:5531479)[Schizosaccharomyces pombe] |
| AN6555.4 [Search PubMed] | hydrolase, alpha/beta fold family, putative (AFU_orthologue; AFUA_6G04640) |
| AN6556.4 [Search PubMed] | hypothetical protein |
| AN6557.4 [Search PubMed] | NADH-ubiquinone oxidoreductase B14 subunit, putative (AFU_orthologue; AFUA_6G04620) |
| AN6558.4 [Search PubMed] | DNA-directed RNA polymerase I and III 14 KDA polypeptide (AFU_orthologue; AFUA_6G04610); Comment: similar to DNA-directed RNA polymerases I and III 16 kDa polypeptide (EC 2.7.7.6)(AC19) (SP:P28000) [Saccharomyces cerevisiae] |
| AN6559.4 [Search PubMed] | transposase Tan1-Aspergillus niger (ANG_orthologue; An07g09460); Comment: Clutterbuck: in Mariner-6_AN (Kapitonov & Jurka 2003 RepBase reports 3; 214 ) co-ordinates 192809-190947 |
| AN6560.4 [Search PubMed] | conserved hypothetical protein |
| AN6561.4 [Search PubMed] | pre-rRNA processing protein, putative (AFU_orthologue; AFUA_6G04590) |
| AN6562.4 [Search PubMed] | NIF domain protein (AFU_orthologue; AFUA_6G04580) |
| AN6563.4 [Search PubMed] | elongation factor 1-gamma, putative (Eurofung); Comment: Meyer, V: high similarity to the S. cerevisiae Cam1p (Calcium And Membrane-binding protein homologous to translation elongation factor 1-gamma; SGD: S000005969; PMID: 8465602) and to the elongation factor 1-gamma 2 of A. fumigatus (GI:70984206) |
| AN6564.4 [Search PubMed] | 37S ribosomal protein S9 (AFU_orthologue; AFUA_6G04560) |
| AN6565.4 [Search PubMed] | conserved hypothetical protein |
| AN6566.4 [Search PubMed] | calcineurin subunit B, putative (Eurofung); Comment: Specht: strong similarity to S. cerevisiae Cnb1p (PMID: 1321337) and A. fumigatus calcineurin regulatory subunit (PMID: 16372009) |
| AN6567.4 [Search PubMed] | histone acetyltransferase complex component Epl1, putative (AFU_orthologue; AFUA_6G04530); Comment: Pocsi, Miskei, Karanyi: Orthologue of S.cerevisiae:EPL1, S.pombe:Epl1 involved in DNA repair, product name: Component of NuA4, which is an essential histone H4/H2A acetyltransferase complex |
| AN6568.4 [Search PubMed] | SET domain protein (AFU_orthologue; AFUA_6G04520) |
| AN6569.4 [Search PubMed] | O-sialoglycoprotein endopeptidase (AFU_orthologue; AFUA_6G04510); Comment: Clutterbuck: suDproA suppressor of proA: AJ293803 |
| AN6570.4 [Search PubMed] | Snf1 kinase complex beta-subunit Gal83, putative (AFU_orthologue; AFUA_6G04500) |
| AN6571.4 [Search PubMed] | alpha-1,2-mannosyltransferase (Mnn2), putative (AFU_orthologue; AFUA_6G04450); Comment: Geysens: best hit observed after blastp analysis of the database using the yeast MNN2/TTP1/CRV4/LDB8/YBR015C gene product (an alpha-1,2- mannosidase responsible for the addition of the first alpha-1,2-linked mannose to the alpha-1,6-mannose outer chain). Second best hit was AN6857.3. Significant sequence similarity of AN6571.3 to MNN2 was confirmed after backblast to the yeast database (e-value = 2.4E-35; but also 6.6E-35 when compared to MNN5). Surprisingly, when performing a backblast analysis on AN6857.3, following e-values were obtained: 4.5E-39 for MNN2 and 8.7E-44 for MNN5. So although AN6857.3 has more homology to MNN5 than to MNN2, it also (based on the backblast analysis) seems to have higher sequence similarity towards MNN2 than does AN6571.3. |
| AN6572.4 [Search PubMed] | molecular chaperone (ABC1), putative (AFU_orthologue; AFUA_6G04380) |
| AN6573.4 [Search PubMed] | conserved hypothetical protein |
| AN6574.4 [Search PubMed] | histone ubiquitinationc protein (Bre1), putative (AFU_orthologue; AFUA_6G04390) |
| AN6575.4 [Search PubMed] | putative Myb-like transcription factor (Eurofung); Comment: Clutterbuck:104 nt Gypsy-3_AN_LTR fragment in exon 2 (Kapitonov & Jurka 2003 RepBase reports 3; 189 ) co-ordinates 232990-232886 Heinekamp: Similar to A. oryzae transcription initiation factor TFIIIB, Bdp1 subunit (AO090701000103); similar to Afu6g04400; |
| AN0726.4 [Search PubMed] | SUN domain protein (Adg3), putative (AFU_orthologue; AFUA_1G13940); Comment: Piet de Groot: GPI-anchored protein according to BIG-PI Fungal Predictor. Presumably related to septation because deletion of SUN4 in S. cerevisiae and of its homologue Psu1 in S. pombe results in defective septation |
| AN0725.4 [Search PubMed] | DUF292 domian protein (AFU_orthologue; AFUA_1G13960) |
| AN10115.4 [Search PubMed] | MFS transporter, putative (AFU_orthologue; AFUA_1G13970) |
| AN10116.4 [Search PubMed] | conserved hypothetical protein |
| AN0723.4 [Search PubMed] | hypothetical protein |
| AN0722.4 [Search PubMed] | AP-2 adaptor complex subunit sigma, putative (AFU_orthologue; AFUA_1G14010); Comment: similar to clathrin coat assembly protein (GI:4538667) {Schizosaccharomyces pombe} |
| AN0721.4 [Search PubMed] | hypothetical protein |
| AN0720.4 [Search PubMed] | diphthine synthase, putative (AFU_orthologue; AFUA_1G14020) |
| AN0719.4 [Search PubMed] | SAGA-like transcriptional regulatory complex subunit Spt3, putative (AFU_orthologue; AFUA_1G14030) |
| AN0718.4 [Search PubMed] | Putative Zn(II)2Cys6 transcription factor (Eurofung); Comment: Manually curated A.F.J Ram and P.J. Punt |
| AN0717.4 [Search PubMed] | Histidinol-phosphate aminotransferase (Eurofung); Comment: M Jones SP:P36605: Histidinol-phosphate aminotransferase (EC 2.6.1.9) (Imidazole acetol-phosphate transaminase). {Schizosaccharomyces pombe;}^GB|CAC37506.1|13872535|AL672257 histidinol-phosphate aminotransferase imidazole acetol phosphate transaminase (PMID 8159167); involved in histidine biosynthesis (7/9th step); similar to S. cerevisiae HIS5 |
| AN0716.4 [Search PubMed] | conserved hypothetical protein |
| AN0715.4 [Search PubMed] | chromosome segregation protein BIR1, putative (AFU_orthologue; AFUA_1G14070) |
| AN0714.4 [Search PubMed] | C2H2 finger domain protein, putative (AFU_orthologue; AFUA_1G14060) |
| AN10117.4 [Search PubMed] | F-box domain protein (AFU_orthologue; AFUA_1G14050) |
| AN0713.4 [Search PubMed] | conserved hypothetical protein |
| AN0712.4 [Search PubMed] | beta-1,4-glucosidase (Eurofung); Comment: H.Visser: Function based on activity. CAZY family GH3. |
| AN0711.4 [Search PubMed] | alpha-rhamnosidase (Eurofung); Comment: R.P. de Vries: function based on sequence similarity CAZY family GH78 |
| AN0710.4 [Search PubMed] | conserved hypothetical protein |
| AN0709.4 [Search PubMed] | Putative C2H2 finger domain transcription factor (Eurofung); Comment: hypothetical protein similar to SILG ; Clutterbuck: silG; AY577543: "C2H2 type zinc finger; involved in repression of sexual development by visible light" |
| AN6577.4 [Search PubMed] | mitochondrial translation optimization protein (Mto1), putative (AFU_orthologue; AFUA_6G04440) |
| AN6578.4 [Search PubMed] | camp independent regulatory protein (AFU_orthologue; AFUA_6G04490) |
| AN11521.4 [Search PubMed] | hypothetical protein |
| AN6579.4 [Search PubMed] | conserved hypothetical protein |
| AN6580.4 [Search PubMed] | phosphatidyl synthase (AFU_orthologue; AFUA_6G04460) |
| AN11522.4 [Search PubMed] | hypothetical protein |
| AN6581.4 [Search PubMed] | ABC multidrug transporter (Eurofung); Comment: gene product name updated- Ian Paulsen Pocsi, Miskei, Karanyi: Orthologue of C.albicans:SNQ2, S.cerevisiae:SNQ2 involved in response to singlet oxygen, product name: ABC transporter protein |
| AN6582.4 [Search PubMed] | conserved hypothetical protein |
| AN6583.4 [Search PubMed] | conserved hypothetical protein |
| AN6584.4 [Search PubMed] | conserved hypothetical protein |
| AN6585.4 [Search PubMed] | DEAH-box RNA helicase (Dhr1), putative (AFU_orthologue; AFUA_6G04330) |
| AN6586.4 [Search PubMed] | RNA binding protein, putative (AFU_orthologue; AFUA_6G04320) |
| AN6587.4 [Search PubMed] | mRNA binding protein Pumilio 2, putative (AFU_orthologue; AFUA_6G04310) |
| AN6588.4 [Search PubMed] | hypothetical protein |
| AN6589.4 [Search PubMed] | phosphoethanolamine N-methyltransferase, putative (AFU_orthologue; AFUA_6G04290) |
| AN6590.4 [Search PubMed] | tuberin (Eurofung); Comment: Pocsi, Miskei, Karanyi: Orthologue of S.pombe:Tsc2 involved in cellular response to nitrogen starvation, product name: Tuberin |
| AN6591.4 [Search PubMed] | chromosome segregation protein Cse1, putative (AFU_orthologue; AFUA_6G04010) |
| AN6592.4 [Search PubMed] | conserved hypothetical protein |
| AN6593.4 [Search PubMed] | hypothetical protein |
| AN6594.4 [Search PubMed] | cell cycle control protein Cdc123 (AFU_orthologue; AFUA_6G04050) |
| AN10841.4 [Search PubMed] | peroxisomal D3,D2-enoyl-CoA isomerase (AFU_orthologue; AFUA_6G04040) |
| AN10834.4 [Search PubMed] | conserved hypothetical protein |
| AN6596.4 [Search PubMed] | conserved hypothetical protein |
| AN6597.4 [Search PubMed] | conserved hypothetical protein |
| AN6598.4 [Search PubMed] | conserved hypothetical protein |
| AN6599.4 [Search PubMed] | DUF28 domain protein (AFU_orthologue; AFUA_6G04090) |
| AN6600.4 [Search PubMed] | Mis6 domain protein (AFU_orthologue; AFUA_6G04100) |
| AN6601.4 [Search PubMed] | CLPTM1 domain protein (AFU_orthologue; AFUA_6G04110) |
| AN6602.4 [Search PubMed] | short chain dehydrogenase/reductase family protein (AFU_orthologue; AFUA_6G04120) |
| AN6603.4 [Search PubMed] | conserved hypothetical protein |
| AN6604.4 [Search PubMed] | killer toxin sensitivity protein (Iki1), putative (AFU_orthologue; AFUA_6G04170) |
| AN10835.4 [Search PubMed] | conserved hypothetical protein |
| AN10839.4 [Search PubMed] | conserved hypothetical protein |
| AN6606.4 [Search PubMed] | mannosyl-oligosaccharide glucosidase, putative (AFU_orthologue; AFUA_6G04210); Comment: Geysens: hit obtained after blastp analysis on the A. nidulans database using the yeast CWH41/GLS1/DER7/YGL027c gene product (i.e. glucosidase I). High sequence similarity was confirmed via backblastp analysis against the yeast database (e-value = 9.9E-132 for CWH41). Remarkebly: the A. nidulans (and also niger) gene encodes for a gene product with a C-terminal HDEL-tag, not for a transmembrane region. The latter is typically observed for the glucosidase I proteins of both S. cerevisiae and mammalian organisms. So in the Aspergillus case, glucosidase I seems to be an ER-luminal protein and not a type 2 transmembrane protein. Alignment of the protein sequence of A. nidulans with that of humans (X87237) clearly indicates a lack of about 50 N-terminal Aa for the fungal enzyme (corresponding to the cytoplasmic and transmembrane region in the case of the human protein). |
| AN6607.4 [Search PubMed] | conserved hypothetical protein |
| AN6608.4 [Search PubMed] | conserved hypothetical protein |
| AN6609.4 [Search PubMed] | RING finger protein (AFU_orthologue; AFUA_6G04230) |
| AN6610.4 [Search PubMed] | PAP2 domain protein (AFU_orthologue; AFUA_6G04240) |
| AN6611.4 [Search PubMed] | pheromone-dependent cell cycle arrest protein Far11, putative (AFU_orthologue; AFUA_6G04250) |
| AN6612.4 [Search PubMed] | ribosomal large subunit biogenesis protein MAK16, putative (AFU_orthologue; AFUA_6G04260) |
| AN6613.4 [Search PubMed] | hypothetical protein |
| AN6614.4 [Search PubMed] | Putative phospholipid P-type ATPase transporter (Eurofung); Comment: gene product name updated- Ian Paulsen Espeso, EA: Gene structure updated. Putative aminophospholipid translocase (flippase) involved in endocytosis and vacuolar biogenesis by similarity to Neo1 from S. cerevisiae. |
| AN6615.4 [Search PubMed] | Putative COPII vesicle coat protein Sec16 (Eurofung); Comment: T.Pakula: SP:O14029: Multidomain vesicle coat protein. {Schizosaccharomyces pombe;} (exp=-1; wgp=-1; cg=-1; genomes=-1; )^|^RF|NP_594985.1|19115897|NC_003424 hypothetical protein {Schizosaccharomyces pombe 972h-;} (exp=-1; wgp=0; cg=1; genomes=1; )^|^RF|NP_594985.1|19115897|NM_001020416 hypothetical protein {Schizosaccharomyces pombe 972h-;} (exp=-1; wgp=0; cg=1; genomes=0; )^|^GB|CAB16252.2|7106087|AL672256 involved in ER to Golgi transport; involved in vesicle formation; similar to S. cerevisiae SEC16 {Schizosaccharomyces pombe 972h-;} (exp=-1; wgp=1; cg=1; genomes=1; )^|^GB|CAB16252.2|7106087|SPAC29B12 involved in ER to Golgi transport; involved in vesicle formation; similar to S. cerevisiae SEC16 {Schizosaccharomyces pombe;} (exp=-1; wgp=0; cg=-1; genomes=0; ) |
| AN6616.4 [Search PubMed] | hypothetical protein similar to NUV101 (Eurofung); Comment: Clutterbuck: nuvG mutant is near-UV-sensitive: AAO27532.1 |
| AN6617.4 [Search PubMed] | GAS2 domain protein (AFU_orthologue; AFUA_6G03990) |
| AN6618.4 [Search PubMed] | GTPase activating protein (Gyp7), putative (AFU_orthologue; AFUA_6G03940) |
| AN10842.4 [Search PubMed] | conserved hypothetical protein |
| AN10836.4 [Search PubMed] | iron-sulfur cluster-binding protein, putative (AFU_orthologue; AFUA_6G03920) |
| AN6620.4 [Search PubMed] | endo-1,3(4)-beta-glucanase, putative (AFU_orthologue; AFUA_6G14540); Comment: similar to endo-1,3-beta-glucanase (GI:6911223) {Streptomyces sioyaensis}. |
| AN6621.4 [Search PubMed] | conserved hypothetical protein |
| AN6622.4 [Search PubMed] | conserved hypothetical protein |
| AN6623.4 [Search PubMed] | MFS transporter, putative (AFU_orthologue; AFUA_6G03860) |
| AN6624.4 [Search PubMed] | tetratricopeptide repeat protein (AFU_orthologue; AFUA_6G03870) |
| AN6625.4 [Search PubMed] | F-box domain protein (AFU_orthologue; AFUA_6G03900) |
| AN6626.4 [Search PubMed] | integral membrane protein, Mpv17/PMP22 family, putative (AFU_orthologue; AFUA_6G03910) |
| AN6627.4 [Search PubMed] | signal sequence receptor alpha subunit, putative (AFU_orthologue; AFUA_6G03850); Comment: Archer: likely component of signal recognition complex, SRP54 (Saccharomyces cerevisiae). |
| AN6628.4 [Search PubMed] | ER to Golgi transport protein Yif1 (AFU_orthologue; AFUA_6G03840) |
| AN6629.4 [Search PubMed] | ribosomal protein L14 (AFU_orthologue; AFUA_6G03830) |
| AN6630.4 [Search PubMed] | nascent polypeptide-associated complex (NAC) subunit, putative (AFU_orthologue; AFUA_6G03820) |
| AN6631.4 [Search PubMed] | ATP synthase D chain, mitochondrial, putative (AFU_orthologue; AFUA_6G03810) |
| AN6632.4 [Search PubMed] | Ribosomal protein S28e (AFU_orthologue; AFUA_7G04490) |
| AN6633.4 [Search PubMed] | conserved hypothetical protein |
| AN6634.4 [Search PubMed] | conserved hypothetical protein |
| AN6635.4 [Search PubMed] | conidial laccase I precursor (Eurofung); Comment: Helmstaedt: RF:XP_664239.1: laccase precursor {Aspergillus nidulans FGSC A4;} PMID: 2192364, PMID: 8491194, PMID: 2659435 Clutterbuck: conidial laccase |
| AN6636.4 [Search PubMed] | oxidoreductase (Msc7), putative (AFU_orthologue; AFUA_6G03770) |
| AN10840.4 [Search PubMed] | hypothetical base excision DNA repair protein (Eurofung); Comment: M Jones PF00730: base excision DNA repair protein, HhH-GPD family GB:BAD37897.1: HhH-GPD base excision DNA repair protein-related-like {Oryza sativa (japonica cultivar-group);} |
| AN10837.4 [Search PubMed] | amidophosphoribosyltransferase (Eurofung); Comment: Clutterbuck: homology confirmed in A. niger and N. crassa |
| AN6638.4 [Search PubMed] | hypothetical protein similar to c5 cytosine methyltransferase DmtA (Eurofung); Comment: Clutterbuck: gene symbol: dmtA; |
| AN6639.4 [Search PubMed] | 2-methylcitrate dehydratase (Eurofung); Comment: M Jones TIGR02330: 2-methylcitrate dehydratase, propionate catabolic process GB:BAE61917.1: unnamed protein product; uncharacterized protein involved in propionate catabolism {Aspergillus oryzae;} (exp=-1; wgp=1; cg=-1; genomes=0; ) SP:P77243: 2-methylcitrate dehydratase (EC 4.2.1.79). {Escherichia coli;} (exp=-1; wgp=-1; cg=-1; genomes=-1; ) |
| AN6640.4 [Search PubMed] | amidohydrolase, putative (AFU_orthologue; AFUA_6G03710) |
| AN6641.4 [Search PubMed] | conserved hypothetical protein |
| AN6642.4 [Search PubMed] | sodium ion P-type ATPase (Eurofung); Comment: gene product name updated- Ian Paulsen Espeso, EA: Gene structure updated. Putative P-type ATPase sodium pump, similar to ENA proteins from S. cerevisiae. Pocsi, Miskei, Karanyi: Orthologue of N.crassa:ENA-1 involved in response to osmotic stress, product name: Sodium P-type ATPase |
| AN6643.4 [Search PubMed] | biotin synthase (Eurofung); Comment: Clutterbuck/Flipphi The position of biotin biosynthesis cluster suggests that biA (biotin requirement) gene is one of AN6643.3 - AN6645.3 Biotin synthase (dethiobiotin:sulfur sulfurtransferase) catalyses the conversion of dethiobiotin to biotin, last step of the biotin biosynthesis. Similar (Expect = 3e-94; Identities 57%, Positives 77%) to the functional S. cerevisiae Biotin synthase, Bio2p, that complements the bioB mutation in E. coli. sp|P32451|1705465|BIOB_YEAST Biotin synthase, mitochondrial precursor (Biotin synthetase) PMID: 8117110 (characterisation of the yeast BIO2 gene) |
| AN6644.4 [Search PubMed] | probable bifunctional dethiobiotin synthetase/adenosylmethionine-8-amino-7-oxononanoate aminotransferase (Eurofung); Comment: Flipphi/Clutterbuck position of biotin synthesis cluster suggests that biA (biotin requirement) gene is one of AN6643.3 - AN6645.3 The AN6644 protein has separate domains for dethiobiotin synthetase and adenosylmethionine-8-amino-7-oxononanoate aminotransferase, catalysing the third and the second step of biotin biosynthesis, respectively. The N-terminal domain is similar (Identities 36%, Positives 47%) to the product of the Arabidopsis thaliana mRNA At5g57600 and somewhat less similar (Identities 31%, Positives 48%) with E. coli dethiobiotin synthetase, encoded by the bioD gene. gi|34146852|gb|AAQ62434.1|At5g57600 [Arabidopsis thaliana] The C-terminal domain is similar (Identities 38%, Positives 53%) to the product of the Arabidopsis thaliana BIO1 mRNA and less similar (Identities 25%, Positives 38%) with E. coli adenosyl-methionine-8-amino-7-oxononanoate transaminase, encoded by the bioA gene. gi|15242787|ref|NP_200567|BIO1 (BIOTIN AUXOTROPH 1) [Arabidopsis thaliana] |
| AN6645.4 [Search PubMed] | probable 8-amino-7-oxononanoate synthase (Eurofung); Comment: Flipphi/Clutterbuck position of biotin biosynthesis cluster suggests that the biA (biotin requirement) gene is one of AN6643.3 - AN6645.3 8-amino-7-oxononanoate synthase (7-keto-8-aminopelargonate synthetase) catalyses the formation of 8-amino-7-oxononanoate from 6-carboxyhexanoyl-CoA and L-alanine, the first step of biotin biosynthesis. This enzyme is absent in S. cerevisiae. Similar (Expect = 6e-31; Identities 33%, Positives = 49%) to the functional Escherichia coli protein, the product of the bioF gene. sp|P12998|115010|BIOF_ECOLI 8-amino-7-oxononanoate synthase (AONS) (8-amino-7-ketopelargonate synthase) (7-keto-8-amino-pelargonic acid synthetase) (7-KAP synthetase) (L-alanine-pimelyl CoA ligase) PMID: 3058702 (E. coli biotin biosynthetic operon) PMID: 9813126 (crystal structure of the E.coli enzyme) |
| AN6646.4 [Search PubMed] | conserved hypothetical protein |
| AN6647.4 [Search PubMed] | conserved hypothetical protein |
| AN11523.4 [Search PubMed] | hypothetical protein |
| AN6648.4 [Search PubMed] | conserved hypothetical protein |
| AN6649.4 [Search PubMed] | very-long-chain acyl-CoA synthetase family protein (CefD1), putative (AFU_orthologue; AFUA_6G03630) |
| AN6650.4 [Search PubMed] | 2-methylcitrate synthase, mitochondrial precursor (Eurofung); Comment: Clutterbuck: methylcitrate synthase gene, cloned. emb|AJ249117|5763967|Aspergillus nidulans mitochondrial mcsA gene for methyl citrate synthase. NB. Protein is mitochondrial, not the gene. emb|CAB53336|5763968|methylcitrate synthase [Emericella nidulans] sp|Q9TEM3|37082393|2-methylcitrate synthase, mitochondrial precursor (Methylcitrate synthase) (Citrate synthase 2) PMID:10712680 (sequence and function mcsA gene) Flipphi: added EC number, accessions EMBL & SwissProt, GO:0019629 |
| AN6651.4 [Search PubMed] | mRNA-nucleus export ATPase (Elf1), putative (AFU_orthologue; AFUA_6G03580) |
| AN6652.4 [Search PubMed] | beta-glucosidase (Eurofung); Comment: R.P. de Vries: Function based on sequence similarity CAZY family GH3 |
| AN6653.4 [Search PubMed] | Malate Synthase (Eurofung); Comment: Flipphi emb|CAA39993.1|2702|malate synthase [Emericella nidulans] sp|P28344|126765|MASY_EMENI, Malate synthase, glyoxysomal emb|X56671.1|2701|A.nidulans malate synthase gene PMID: 1832736 PMID: 9818356 (peroxisomal localization) PMID: 3622 (i.e. selection of acu mutants) |
| AN6654.4 [Search PubMed] | glutamine synthetase, putative (AFU_orthologue; AFUA_6G03530) |
| AN6655.4 [Search PubMed] | short-chain dehydrogenase/reductase family protein, putative (AFU_orthologue; AFUA_6G03520) |
| AN6656.4 [Search PubMed] | endopolygalacturonase (Eurofung); Comment: R.P. de Vries: Function based on sequence similarity CAZY family gh28 |
| AN6657.4 [Search PubMed] | conserved hypothetical protein |
| AN6658.4 [Search PubMed] | flavin containing polyamine oxidase, putative (AFU_orthologue; AFUA_6G03510) |
| AN6659.4 [Search PubMed] | short chain dehydrogenase (AtsC), putative (AFU_orthologue; AFUA_3G00180) |
| AN6660.4 [Search PubMed] | conserved hypothetical protein |
| AN11524.4 [Search PubMed] | hypothetical protein |
| AN6661.4 [Search PubMed] | hypothetical protein |
| AN10843.4 [Search PubMed] | conserved hypothetical protein |
| AN10838.4 [Search PubMed] | conserved hypothetical protein; Comment: Hiroyuki Horiuchi: Homology with class V chitinase A. fumigatus |
| AN6663.4 [Search PubMed] | conserved hypothetical protein |
| AN6664.4 [Search PubMed] | hypothetical protein |
| AN6665.4 [Search PubMed] | conserved hypothetical protein; Comment: Clutterbuck: 63 nt 5SrRNA fragment in exon3 co-ordinates 279215-279152 |
| AN6666.4 [Search PubMed] | conserved hypothetical protein |
| AN6667.4 [Search PubMed] | Putative Zn(II)2Cys6 transcription factor (Eurofung); Comment: Manually curated A.F.J Ram and P.J. Punt; Afu orthologue: AFUA_4G14220 |
| AN6668.4 [Search PubMed] | conserved hypothetical protein |
| AN6669.4 [Search PubMed] | high-affinity glucose tranporter (MstC) (Eurofung); Comment: A.P.MacCabe comments: Emericella nidulans mstC gene, exons 1-4 gi|87158046|emb|AJ879992 putative sugar transporter [Emericella nidulans] gi|87158047|emb|CAI54231 AUTHORS MacCabe,A.P., Gonzalez,R., Ventura,L., Forment,J.V., Flipphi,M.J.A. and Ramon,D. TITLE The Aspergillus nidulans mstC gene encodes a putative glucose transporter - unpublished |
| AN6670.4 [Search PubMed] | conserved hypothetical protein |
| AN6671.4 [Search PubMed] | conserved hypothetical protein |
| AN6672.4 [Search PubMed] | conserved hypothetical protein |
| AN6673.4 [Search PubMed] | alpha-fucosidase (Eurofung); Comment: R.P.de Vries: function based on sequence similarity CAZY family GH95 |
| AN6674.4 [Search PubMed] | conserved hypothetical protein |
| AN6675.4 [Search PubMed] | PHD finger domain protein, putative (AFU_orthologue; AFUA_7G05250) |
| AN6676.4 [Search PubMed] | transformer-SR ribonucleoprotein, putative (AFU_orthologue; AFUA_7G05260) |
| AN6677.4 [Search PubMed] | COMPASS complex subunit Sdc1, putative (AFU_orthologue; AFUA_7G05270) |
| AN6678.4 [Search PubMed] | conserved hypothetical protein |
| AN6679.4 [Search PubMed] | hypothetical protein similar to 40s ribosomal protein s13 (Broad) |
| AN6680.4 [Search PubMed] | conserved hypothetical protein |
| AN6681.4 [Search PubMed] | splicing factor u2af large subunit (AFU_orthologue; AFUA_7G05310) |
| AN6682.4 [Search PubMed] | mitochondrial glycosylase/lyase (Eurofung); Comment: Pocsi, Miskei, Karanyi: Orthologue of C.albicans:ORF19.7190, S.cerevisiae:OGG1 involved in DNA repair, base-excision repair, AP site formation , product name: Mitochondrial glycosylase/lyase , EC number: 4.2.99.18 |
| AN6683.4 [Search PubMed] | conserved hypothetical protein |
| AN6684.4 [Search PubMed] | Putative Zn(II)2Cys6 transcription factor (Eurofung); Comment: Manually curated A.F.J Ram and P.J. Punt |
| AN6685.4 [Search PubMed] | cellular morphogenesis protein (Rax2), putative (AFU_orthologue; AFUA_7G05340); Comment: Putative homologue of Saccharomyces cerevisiae´bud site selection protein Rax2. entered by S. Harris (11/30/2006) |
| AN6686.4 [Search PubMed] | conserved hypothetical protein |
| AN6687.4 [Search PubMed] | FACT complex component (Eurofung); Comment: Pocsi, Miskei, Karanyi: Orthologue of S.pombe:SPBC609.05 involved in DNA repair, product name: FACT complex component |
| AN6688.4 [Search PubMed] | septin B (Eurofung); Comment: GB:AAB41233.1: septin B {Emericella nidulans;} Orthologue of Saccharomyces CDC3 Involved in chromosome segregation and initiation of cytokinesis PMID: 7489714 |
| AN6689.4 [Search PubMed] | conserved hypothetical protein |
| AN6690.4 [Search PubMed] | mitochondrial carrier protein, putative (AFU_orthologue; AFUA_7G05390) |
| AN6691.4 [Search PubMed] | conserved hypothetical protein; Comment: Clutterbuck: in DNA-2_AN (Kapitonov & Jurka 2003 RepBase reports 3; 204) co-ordinates 4399-1 |
| AN6692.4 [Search PubMed] | hypothetical protein; Comment: Clutterbuck: in DNA-2_AN (Kapitonov & Jurka 2003 RepBase reports 3; 204) co-ordinates 4399-1 |
| AN6693.4 [Search PubMed] | hypothetical protein |
| AN6694.4 [Search PubMed] | sister chromatid cohesion factor (Chl12), putative (AFU_orthologue; AFUA_7G05480) |
| AN6695.4 [Search PubMed] | nonsense-mediated mRNA decay factor (Upf2), putative (AFU_orthologue; AFUA_7G05430); Comment: similar to regulator of nonsense transcripts 2 (GI:11228926) {Homo sapiens} PMID:11073994 |
| AN6696.4 [Search PubMed] | transcription factor Tos4, putative (AFU_orthologue; AFUA_7G05440) |
| AN6697.4 [Search PubMed] | SUN domain protein (Eurofung); Comment: De Groot: member of the Sun family, possibly involved in septation. Deletion of SUN4 in S cerevisiae or its homolog (Psu1) in S. pombe results in defective septation |
| AN11525.4 [Search PubMed] | hypothetical protein |
| AN6698.4 [Search PubMed] | conserved hypothetical protein |
| AN10852.4 [Search PubMed] | conserved hypothetical protein |
| AN6699.4 [Search PubMed] | electron transfer flavoprotein alpha subunit, putative (AFU_orthologue; AFUA_7G05470) |
| AN6700.4 [Search PubMed] | elongation factor 3 (Eurofung); Comment: M Jones SP:O93796 Elongation factor 3 (EF-3). RF:XP_748943.1: elongation factor EF-3 {Aspergillus fumigatus Af293;} (exp=-1; wgp=0; cg=1; genomes=1;) GB:AAA35233.1: elongation factor 3 {Saccharomyces cerevisiae;} (exp=-1; wgp=0; cg=-1; genomes=0; ) |
| AN6701.4 [Search PubMed] | glutamine-serine rich protein MS8, putative (AFU_orthologue; AFUA_7G05650) |
| AN6702.4 [Search PubMed] | GPI maturation protein (Bst1), putative (AFU_orthologue; AFUA_7G05540) |
| AN6703.4 [Search PubMed] | sugar transporter family protein (AFU_orthologue; AFUA_7G05550) |
| AN6704.4 [Search PubMed] | conserved hypothetical protein |
| AN6705.4 [Search PubMed] | component of the RSC chromatin remodeling complex (Eurofung); Comment: similar to chromatin structure remodeling complex protein RSC8; remodels the structure of chromatin complex subunit 8; SWI3 homolog (SP:P43609) [Saccharomyces cerevisiae]. contains SWIRM domain. Pocsi, Miskei, Karanyi: Orthologue of S.cerevisiae:RSC8 involved in double-strand break repair via nonhomologous end joining, product name: Component of the RSC chromatin remodeling complex |
| AN6706.4 [Search PubMed] | conserved hypothetical protein |
| AN6707.4 [Search PubMed] | DEAD/DEAH box helicase, putative (AFU_orthologue; AFUA_7G05530) |
| AN6708.4 [Search PubMed] | hypothetical protein similar to dihydrolipoamide acyltransferase, pyruvate dehydrogenase E2 component (Eurofung); Comment: Flipphi hypothetical protein similar (Identities 49%, Positives 63%) to yeast Pda2p (Lat1p), the dihydrolipoamide S-acetyltransferase (E2) component of the (mitochondrial) pyruvate dehydrogenase complex. The corresponding gene in Neurospora crassa (mrp-3) was identified while screening for gene products associated with mitochondrial ribosomes but not recognised as dihydrolipoamide S-acetyltransferase. sp|P12695|129060|ODP2_YEAST Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial precursor(Pyruvate dehydrogenase complex E2 component) (PDC-E2) gb|AAA60452|623207|NEURPNUC mitochondrial ribosomal protein PMID: 5660115 (first Aspergillus nidulans pdhA mutant) PMID: 321417 (A. nidulans pdhA mutants) PMID: 7028719 (more pdhA mutants) PMID: 1958662 (yeast deletion mutant) PMID: 3050999 (yeast PDA2 gene) PMID: 2521217 (Neurospora crassa mrp-3 gene) |
| AN10850.4 [Search PubMed] | hypothetical protein |
| AN6709.4 [Search PubMed] | guanyl-nucleotide exchange factor (Sec7), putative (AFU_orthologue; AFUA_7G05700); Comment: Clutterbuck: suAhypB: suppressor of hypB: (mistakenly described as "hypB", chromosome VII, in AY261780 |
| AN6710.4 [Search PubMed] | siroheme synthase Met8, putative (AFU_orthologue; AFUA_7G05680) |
| AN6711.4 [Search PubMed] | ribose phosphate diphosphokinase Prs1, putative (AFU_orthologue; AFUA_7G05670) |
| AN6712.4 [Search PubMed] | hypothetical protein similar to phospholipase D (Eurofung); Comment: Clutterbuck: pldA: phospholipase D; AB092651; GI:29467473; PMID:12892887. Deletion normal, but with reduced activity against phosphatidylethanolamine. In wild type this activity increased by high osmotic conditions. |
| AN6713.4 [Search PubMed] | DUF890 domain protein (AFU_orthologue; AFUA_7G05590) |
| AN6714.4 [Search PubMed] | TPR domain protein (AFU_orthologue; AFUA_7G05600) |
| AN6715.4 [Search PubMed] | putative APSES transcription factor similar to MbpA (Eurofung); Comment: Heinekamp, T.: similar to APSES transcription factor MbpA {Aspergillus fumigatus Af293;} Afu7g05620; Pfam domain Apses position 119-202; e-value 1.8e-39 contains Ankyrin Repeat Pfam domain PF00023 (protein interaction) GB:AAK14058.1: MBPA protein {Emericella nidulans;} Clutterbuck: PMID:17617716: swi6 homologue, alternative gene symbol Answi6, deletion has pale conidia |
| AN6716.4 [Search PubMed] | conserved hypothetical protein |
| AN10847.4 [Search PubMed] | conserved hypothetical protein |
| AN6717.4 [Search PubMed] | malate dehydrogenase (Eurofung); Comment: similar to SP|P17505|MDHM_YEAST Malate dehydrogenase, mitochondrial [Precursor]{Saccharomyces cerevisiae} PMID: 3552052 3072021 Clutterbuck: gene symbol mdhA: PMID:15449589 |
| AN6718.4 [Search PubMed] | AAA family ATPase, putative (AFU_orthologue; AFUA_7G05752) |
| AN6719.4 [Search PubMed] | conserved hypothetical protein |
| AN10853.4 [Search PubMed] | conserved hypothetical protein; Comment: turner: GB:AAS01338.1: HbrB {Emericella nidulans;}PMID:14998529 Required for hyphal growth. |
| AN10849.4 [Search PubMed] | hypothetical protein similar to AvaB protein (Eurofung); Comment: Clutterbuck: gene symbols avaB (vacuolar biogenesis: AB090888) and hbrB (hyphal branching) PMID: 14998529 |
| AN10844.4 [Search PubMed] | hypothetical protein similar to fructose-2,6-bisphosphatase (Eurofung); Comment: Flipphi hypothetical protein similar (Expect = 2e-109; Identities 58%, Positives 75%) to Saccharomyces cerevisiae functional fructose-2,6-bisphosphatase: gb|AAB22823.1|253335|fructose-2,6-bisphosphatase [Saccharomyces cerevisiae] gb|S42124.1|253334|FBP26=fructose-2,6-bisphosphatase [Saccharomyces cerevisiae, Genomic, 2446 nt] NB. The yeast gene product is similar to the entire sequence of the bifunctional rat liver enzyme but is predominantly a fructose-2,6-bisphosphatase. PMID: 1322693 |
| AN6721.4 [Search PubMed] | amidohydrolase family protein (AFU_orthologue; AFUA_5G01480) |
| AN10848.4 [Search PubMed] | ribonucleoprotein, putative (AFU_orthologue; AFUA_7G05810) |
| AN10845.4 [Search PubMed] | MFS sugar transporter, putative (AFU_orthologue; AFUA_7G05830) |
| AN6723.4 [Search PubMed] | amidohydrolase family protein (AFU_orthologue; AFUA_7G05840) |
| AN6724.4 [Search PubMed] | conserved hypothetical protein |
| AN6725.4 [Search PubMed] | RING finger domain protein (AFU_orthologue; AFUA_7G05860) |
| AN6726.4 [Search PubMed] | proteasome component Pre8, putative (AFU_orthologue; AFUA_7G05870) |
| AN6727.4 [Search PubMed] | conserved hypothetical protein |
| AN6728.4 [Search PubMed] | conserved hypothetical protein |
| AN6729.4 [Search PubMed] | MOSC domain protein (AFU_orthologue; AFUA_7G05900) |
| AN6730.4 [Search PubMed] | purine permease (Eurofung); Comment: Clutterbuck: uapC: purine permease: X79796; PMID:7721763 |
| AN6731.4 [Search PubMed] | acyl-CoA desaturase (Eurofung); Comment: Clutterbuck: sdeA: stearic acid desaturase: PMID:15050539, PMID:15347747 |
| AN10851.4 [Search PubMed] | conserved hypothetical protein |
| AN6732.4 [Search PubMed] | Myosin light chain, putative (Eurofung); Comment: Meyer, V: putative EF-hand protein with similarity to S. pombe myosin light chain Cdc4, (PMID: 7622565) |
| AN6733.4 [Search PubMed] | C2H2 finger domain protein, putative (AFU_orthologue; AFUA_7G05960) |
| AN6734.4 [Search PubMed] | mRNA transport regulator (Mtr10), putative (AFU_orthologue; AFUA_7G05970) |
| AN6735.4 [Search PubMed] | small nuclear ribonucleoprotein SmE, putative (AFU_orthologue; AFUA_7G05980) |
| AN6736.4 [Search PubMed] | conserved hypothetical protein |
| AN6737.4 [Search PubMed] | conserved hypothetical protein |
| AN6738.4 [Search PubMed] | Nuclear pore complex protein An-Nup170 (Eurofung); Comment: Steve Osmani. Identified as a protein with similarity to S. cerevisiae nuclear pore complex protein NUP170. Endogenously tagged protein locates to the NPC throughout the cell cycle. Potentially a core component of the NPC. Essential. PMID: 16987955 PMID: 15611647 |
| AN6739.4 [Search PubMed] | alpha-ketoglutarate-dependent taurine dioxygenase (AFU_orthologue; AFUA_7G06030) |
| AN6740.4 [Search PubMed] | integral membrane protein, putative (AFU_orthologue; AFUA_7G06040) |
| AN6741.4 [Search PubMed] | DNA damage-inducible v-SNARE binding protein Ddi1, putative (AFU_orthologue; AFUA_7G06050) |
| AN6742.4 [Search PubMed] | salicylate hydroxylase, putative (AFU_orthologue; AFUA_7G00590) |
| AN6743.4 [Search PubMed] | hydrolase, CocE/NonD family, putative (AFU_orthologue; AFUA_7G00600) |
| AN6744.4 [Search PubMed] | hypothetical protein |
| AN6745.4 [Search PubMed] | conserved hypothetical protein |
| AN6746.4 [Search PubMed] | aromatic ring-opening dioxygenase family protein (AFU_orthologue; AFUA_7G00640) |
| AN6747.4 [Search PubMed] | Putative transcription factor with C2H2 and Zn(2)-Cys(6) DNA binding domain (Eurofung); Comment: Afu orthologue: AFUA_7G00652 |
| AN6748.4 [Search PubMed] | pectate lyase (Eurofung); Comment: R.P.de Vries: function based on sequence similarity CAZY family pl3 |
| AN11526.4 [Search PubMed] | hypothetical protein |
| AN6749.4 [Search PubMed] | conserved hypothetical protein |
| AN6750.4 [Search PubMed] | conserved hypothetical protein |
| AN6751.4 [Search PubMed] | glycosyl hydrolase, putative (AFU_orthologue; AFUA_7G06110); Comment: R.P. de Vries: Function unknown CAZY family gh43 |
| AN6752.4 [Search PubMed] | fatty-acyl coenzyme A oxidase (Pox1), putative (AFU_orthologue; AFUA_7G06090) |
| AN6753.4 [Search PubMed] | NADH-dependent flavin oxidoreductase, putative (AFU_orthologue; AFUA_7G06420) |
| AN6754.4 [Search PubMed] | GPI anchored protein, putative (AFU_orthologue; AFUA_7G00450); Comment: De Groot: Predicted GPI-anchored protein according to Big-PI fungal predictor. |
| AN6755.4 [Search PubMed] | acyl-CoA dehydrogenase, putative (AFU_orthologue; AFUA_5G09980) |
| AN6756.4 [Search PubMed] | conserved hypothetical protein |
| AN6757.4 [Search PubMed] | amino acid transporter (Eurofung); Comment: Gene product name updated- Ian Paulsen |
| AN6758.4 [Search PubMed] | conserved hypothetical protein |
| AN6759.4 [Search PubMed] | Putative Zn(II)2Cys6 transcription factor (Eurofung); Comment: Manually curated A.F.J Ram and P.J. Punt |
| AN6760.4 [Search PubMed] | conserved hypothetical protein |
| AN6761.4 [Search PubMed] | acyl-CoA dehydrogenase, putative (AFU_orthologue; AFUA_7G06510) |
| AN6762.4 [Search PubMed] | Putative Zn(II)2Cys6 transcription factor (Eurofung) |
| AN6763.4 [Search PubMed] | conserved hypothetical protein |
| AN6764.4 [Search PubMed] | conserved hypothetical protein |
| AN6765.4 [Search PubMed] | conserved hypothetical protein |
| AN6766.4 [Search PubMed] | conserved hypothetical protein |
| AN6767.4 [Search PubMed] | enoyl-CoA hydratase/isomerase family protein (AFU_orthologue; AFUA_2G14850) |
| AN6768.4 [Search PubMed] | conserved hypothetical protein |
| AN6769.4 [Search PubMed] | conserved hypothetical protein |
| AN6770.4 [Search PubMed] | amino acid transporter (Eurofung); Comment: Gene product name updated- Ian Paulsen |
| AN6771.4 [Search PubMed] | conserved hypothetical protein |
| AN6772.4 [Search PubMed] | conserved hypothetical protein |
| AN6773.4 [Search PubMed] | conserved hypothetical protein; Comment: similar to secretory lipase 6 (GI:8809743) {Candida albicans}. Matches PF03583: Secretory lipase domain. |
| AN6774.4 [Search PubMed] | MFS transporter, putative (AFU_orthologue; AFUA_3G11760) |
| AN6775.4 [Search PubMed] | acyl-CoA:6-aminopenicillanic-acid- acyltransferase, putative (AFU_orthologue; AFUA_3G12620) |
| AN6776.4 [Search PubMed] | dienelactone hydrolase family protein (AFU_orthologue; AFUA_1G01900) |
| AN6777.4 [Search PubMed] | conserved hypothetical protein |
| AN6778.4 [Search PubMed] | phthalate transporter, putative (AFU_orthologue; AFUA_4G03750) |
| AN6779.4 [Search PubMed] | ABC bile acid transporter, putative (Eurofung); Comment: gene product name updated- Ian Paulsen |
| AN6780.4 [Search PubMed] | conserved hypothetical protein |
| AN6781.4 [Search PubMed] | hypothetical protein |
| AN6782.4 [Search PubMed] | amino acid transporter (Eurofung); Comment: Gene product name updated- Ian Paulsen |
| AN6783.4 [Search PubMed] | conserved hypothetical protein |
| AN6784.4 [Search PubMed] | DMATS type aromatic prenyltransferase, putative (JCVI) |
| AN6785.4 [Search PubMed] | CRAL/TRIO domain protein (AFU_orthologue; AFUA_7G06760) |
| AN11527.4 [Search PubMed] | hypothetical protein |
| AN6786.4 [Search PubMed] | endoglucanase, putative (AFU_orthologue; AFUA_7G06740); Comment: R.P.de Vries: unknown function CAZY family gh45 |
| AN6787.4 [Search PubMed] | cytochrome P450, putative (Eurofung); Comment: Similar to GI:13621068: cytochrome P450 [Fusarium sporotrichioides]. Matches PF00067: Cytochrome P450 and PS00086: Cytochrome P450 cysteine heme-iron ligand signature domains. Krasevec & Kelly: ok |
| AN6788.4 [Search PubMed] | Putative Zn(II)2Cys6 transcription factor (Eurofung) |
| AN6789.4 [Search PubMed] | conserved hypothetical protein |
| AN6790.4 [Search PubMed] | Putative Zn(II)2Cys6 transcription factor (Eurofung) |
| AN6791.4 [Search PubMed] | polyketide synthase, putative (JCVI); Comment: similar to polyketide synthase (GI:4959952) {Aspergillus terreus} PMID: 10334994. |
| AN6792.4 [Search PubMed] | glycerol-3-phosphate dehydrogenase (Eurofung); Comment: Pocsi, Miskei, Karanyi: Orthologue of S.pombe:Gpd1 involved in response to osmotic stress, product name: Glycerol-3-phosphate dehydrogenase , EC number: 1.1.1.8 |
| AN6793.4 [Search PubMed] | esterase, putative (AFU_orthologue; AFUA_7G00330) |
| AN11528.4 [Search PubMed] | hypothetical protein; Comment: Clutterbuck: in DNA-4_AN (Kapitonov & Jurka 2003 RepBase reports 3; 206) co-ordinates 336074-331512 |
| AN6794.4 [Search PubMed] | conserved hypothetical protein; Comment: Clutterbuck: in DNA-4_AN (Kapitonov & Jurka 2003 RepBase reports 3; 206) co-ordinates 336074-331512 |
| AN6795.4 [Search PubMed] | antigenic cell wall galactomannoprotein, putative (AFU_orthologue; AFUA_4G00870) |
| AN6796.4 [Search PubMed] | ThiJ/PfpI family protein (AFU_orthologue; AFUA_5G01430) |
| AN6797.4 [Search PubMed] | conserved hypothetical protein |
| AN6798.4 [Search PubMed] | conserved hypothetical protein |
| AN10846.4 [Search PubMed] | conserved hypothetical protein; Comment: Clutterbuck: in Gypsy-1_AN (Kapitonov & Jurka 2003 RepBase reports 3; 188-9 ) co-ordinates 351122-345812 |
| AN6801.4 [Search PubMed] | conserved hypothetical protein |
| AN11529.4 [Search PubMed] | hypothetical protein |
| AN6802.4 [Search PubMed] | hypothetical protein |
| AN6803.4 [Search PubMed] | Pfs, NACHT and WD domain protein (AFU_orthologue; AFUA_7G07100); Comment: similar to beta transducin-like protein HET-D2Y (GI:17225210) [Podospora anserina] contains NACHT and WD40 domains |
| AN6804.4 [Search PubMed] | conserved hypothetical protein |
| AN11530.4 [Search PubMed] | hypothetical protein |
| AN6805.4 [Search PubMed] | conserved hypothetical protein |
| AN6806.4 [Search PubMed] | conserved hypothetical protein |
| AN6807.4 [Search PubMed] | conserved hypothetical protein |
| AN6808.4 [Search PubMed] | conserved hypothetical protein |
| AN6809.4 [Search PubMed] | CRAL/TRIO domain protein (AFU_orthologue; AFUA_5G00680) |
| AN6810.4 [Search PubMed] | ThiJ/PfpI family protein (AFU_orthologue; AFUA_3G01210) |
| AN6811.4 [Search PubMed] | conserved hypothetical protein |
| AN6812.4 [Search PubMed] | conserved hypothetical protein |
| AN6813.4 [Search PubMed] | conserved hypothetical protein |
| AN6815.4 [Search PubMed] | guanine deaminase, putative (AFU_orthologue; AFUA_6G10210) |
| AN6816.4 [Search PubMed] | conserved hypothetical protein |
| AN6817.4 [Search PubMed] | alcohol dehydrogenase, zinc-containing (AFU_orthologue; AFUA_7G04530) |
| AN6818.4 [Search PubMed] | phytanoyl-CoA dioxygenase family protein (AFU_orthologue; AFUA_8G00480) |
| AN6819.4 [Search PubMed] | conserved hypothetical protein |
| AN6820.4 [Search PubMed] | sensor histidine kinase/response regulator, putative (AFU_orthologue; AFUA_4G00660) |
| AN6821.4 [Search PubMed] | hypothetical protein |
| AN10859.4 [Search PubMed] | hypothetical protein |
| AN6822.4 [Search PubMed] | cell morphogenesis protein Las1, putative (AFU_orthologue; AFUA_5G12850) |
| AN6823.4 [Search PubMed] | conserved hypothetical protein |
| AN6824.4 [Search PubMed] | NAD+ kinase, putative (AFU_orthologue; AFUA_5G12870) |
| AN6825.4 [Search PubMed] | transport protein particle (TRAPP) complex subunit TRS31, putative (Eurofung); Comment: T. Pakula: homol. to Transport protein particle subunit trs31 SP:Q9P7N9: Transport protein particle subunit trs31 (TRAPP subunit trs31). {Schizosaccharomyces pombe;} (exp=-1; wgp=-1; cg=-1; genomes=-1; )^|^RF|NP_596451.1|19113243|NM_001022370 hypothetical protein {Schizosaccharomyces pombe 972h-;} (exp=-1; wgp=0; cg=1; genomes=0; )^|^GB|CAB75995.1|7106062|AL672257 TRAPP (predicted); involved in intracellular protein transport (predicted); similar to S. cerevisiae BET3 {Schizosaccharomyces pombe 972h-;} (exp=-1; wgp=1; cg=1; genomes=1; )^|^GB|CAB75995.1|7106062|SPBC1718 TRAPP (predicted); involved in intracellular protein transport (predicted); similar to S. cerevisiae BET3 {Schizosaccharomyces pombe;} (exp=-1; wgp=1; cg=-1; genomes=0; ) |
| AN6826.4 [Search PubMed] | microfibrillar-associated protein MfaP1, putative (AFU_orthologue; AFUA_5G12890) |
| AN6827.4 [Search PubMed] | ssDNA binding protein Ssb3, putative (AFU_orthologue; AFUA_5G12895) |
| AN6828.4 [Search PubMed] | GATA transcription factor (Ams2), putative (AFU_orthologue; AFUA_5G12900) |
| AN6829.4 [Search PubMed] | TPR domain protein (AFU_orthologue; AFUA_5G12710) |
| AN6830.4 [Search PubMed] | conserved hypothetical protein: laccase (Eurofung); Comment: Clutterbuck: lccA, laccase: PMID:16821501 |
| AN6831.4 [Search PubMed] | conserved hypothetical protein |
| AN6832.4 [Search PubMed] | Putative Zn(II)2Cys6 transcription factor (Eurofung); Comment: Afu orthologue: AFUA_6G12130 |
| AN6833.4 [Search PubMed] | hypothetical protein |
| AN6834.4 [Search PubMed] | MFS sugar transporter, putative (AFU_orthologue; AFUA_8G01340) |
| AN6835.4 [Search PubMed] | cytochrome P450, putative (Eurofung); Comment: Similar to SP:Q9Y8G7: Bifunctional P-450:NADPH-P450 reductase (Fatty acid omega-hydroxylase) (P450foxy) [Includes: Cytochrome P450 505 (EC 1.14.14.1); NADPH- cytochrome P450 reductase(EC1.6.2.4)]. {Fusarium oxysporum} PMID:8830036. Similar to fatty acid hydroxylase (GI:27901545)[Aspergillus oryzae]. Matches Cytochrome P450, FAD binding, flavodoxin and Oxidoreductase NAD-binding domains Krasevec & Kelly: ok NADPH-cytochrome P450 reductase - cytochrome P450 fusion protein |
| AN11531.4 [Search PubMed] | hypothetical protein |
| AN6836.4 [Search PubMed] | acetyltransferase, CysE/LacA/LpxA/NodL family (AFU_orthologue; AFUA_2G08430) |
| AN6837.4 [Search PubMed] | Putative Zn(II)2Cys6 transcription factor (Eurofung); Comment: Afu orthologue: AFUA_8G02170 |
| AN6838.4 [Search PubMed] | tubulin beta-2 chain (Eurofung); Comment: Berl Oakley Structure appears correct (AN6838.3) Beta tubulin expressed during conidiation. It is not essential. Reference: May, G.S. et al. (1987) Gene 55:231-243 |
| AN6839.4 [Search PubMed] | conserved hypothetical protein |
| AN6840.4 [Search PubMed] | hydroxyacylglutathione hydrolase, putative (AFU_orthologue; AFUA_5G12840) |
| AN6841.4 [Search PubMed] | mitochondrial inner membrane protease subunit 1, putative (AFU_orthologue; AFUA_5G12820) |
| AN6842.4 [Search PubMed] | mitochondrial large ribosomal subunit YmL35, putative (AFU_orthologue; AFUA_5G12810) |
| AN6843.4 [Search PubMed] | 50S ribosomal protein L4 (AFU_orthologue; AFUA_5G12800) |
| AN6844.4 [Search PubMed] | mitochondrial 3-hydroxyisobutyryl-CoA hydrolase, putative (AFU_orthologue; AFUA_5G12790) |
| AN6845.4 [Search PubMed] | iron-regulated transporter, putative (AFU_orthologue; AFUA_5G12920) |
| AN6846.4 [Search PubMed] | Putative Zn(II)2Cys6 transcription factor (Eurofung); Comment: Afu orthologue: AFUA_5G12930 |
| AN6847.4 [Search PubMed] | arylsulfatase, putative (AFU_orthologue; AFUA_5G12940) |
| AN6848.4 [Search PubMed] | MFS quinate transporter, putative (AFU_orthologue; AFUA_5G12950) |
| AN6849.4 [Search PubMed] | bZIP transcription factor (Atf21), putative (AFU_orthologue; AFUA_5G12960) |
| AN6850.4 [Search PubMed] | conserved hypothetical protein |
| AN10854.4 [Search PubMed] | Snf1 protein kinase complex subunit Snf4, putative (AFU_orthologue; AFUA_5G12990) |
| AN10860.4 [Search PubMed] | conserved hypothetical protein |
| AN6852.4 [Search PubMed] | hypothetical protein; Comment: Clutterbuck: in 2442 nt Helitron-1_AN fragment (Kapitonov & Jurka 2003 RepBase reports 3; ) co-ordinates 162155-164597 |
| AN6853.4 [Search PubMed] | CRAL/TRIO domain protein (AFU_orthologue; AFUA_5G13000) |
| AN6854.4 [Search PubMed] | Apc13 domain protein (AFU_orthologue; AFUA_5G13030) |
| AN10855.4 [Search PubMed] | DNA polymerase alpha/primase associated subunit (AFU_orthologue; AFUA_5G13020) |
| AN10857.4 [Search PubMed] | conserved hypothetical protein |
| AN6856.4 [Search PubMed] | conserved hypothetical protein |
| AN6857.4 [Search PubMed] | alpha-1,2-mannosyltransferase, putative (AFU_orthologue; AFUA_5G13090); Comment: Geysens: first hit obtained after blastp analysis of the A. nidulans database using the yeast MNN5/YJL186w gene product (an alpha-1,2-mannosidase responsible for the addition of a second alpha-1,2-linked mannose residue on the side branches of the alpha-1,6-mannose outer chain). Backblastp analysis to the yeast database results into two hits: first of all MNN5 itself (e-value = 8.7E-44), but also MNN2 (4.5E-39). |
| AN6858.4 [Search PubMed] | conserved hypothetical protein |
| AN6859.4 [Search PubMed] | conserved hypothetical protein |
| AN6860.4 [Search PubMed] | hypothetical protein |
| AN6861.4 [Search PubMed] | DUF1275 domain protein (AFU_orthologue; AFUA_5G13060) |
| AN6862.4 [Search PubMed] | conserved hypothetical protein |
| AN6863.4 [Search PubMed] | kineisn class 3 (Kif1/Unc-104 group) (Eurofung); Comment: Berl Oakley: Identified as kineisn class 3 (Kif1/Unc-104 group) by Dr. Tetsuya Horio Based on initial analysis by Dr. R. Fischer's lab. Reference: Rischitor, P. E. et al. (2004) Eukaryot. Cell 3:632-645 |
| AN6864.4 [Search PubMed] | translation initiation factor eif-2b delta subunit (AFU_orthologue; AFUA_5G13040) |
| AN6865.4 [Search PubMed] | conserved hypothetical protein |
| AN6866.4 [Search PubMed] | chorismate mutase (Eurofung); Comment: Clutterbuck: aroC gene cloned: PMID10428795 aromatic aminoacid biosynthesis M Jones |
| AN6867.4 [Search PubMed] | WD repeat-containing protein (AFU_orthologue; AFUA_5G13140) |
| AN6868.4 [Search PubMed] | conserved hypothetical protein |
| AN6869.4 [Search PubMed] | putative agmatinase (Eurofung); Comment: M Jones Arginase family TIGR01230: agmatinase RF:XP_753336.1: agmatinase {Aspergillus fumigatus Af293;} (exp=-1; wgp=0; cg=1; genomes=1; ) Agmatinase hydrolyses the arginine decarboxylation product agamatine to urea and putrescine, a precursor of the polyamines spermine and spermidine |
| AN6870.4 [Search PubMed] | MATE efflux family protein (Eurofung); Comment: Gene product name updated- Ian Paulsen |
| AN6871.4 [Search PubMed] | MFS transporter, putative (AFU_orthologue; AFUA_5G13160) |
| AN6872.4 [Search PubMed] | conserved hypothetical protein |
| AN6873.4 [Search PubMed] | hypothetical protein |
| AN6874.4 [Search PubMed] | alpha-1,2-mannosyltransferase (Alg2), putative (AFU_orthologue; AFUA_5G13210); Comment: Geysens: hit obtained after blastp analysis using the yeast ALG2/YGL065c gene, encoding a GDP-mannose:Man(1 and/or 2)GlcNAc2 mannosyltransferase. Backblastp analysis confirms high homology (e-value = 1E-85) |
| AN6875.4 [Search PubMed] | kinesin class 4 (Chromokinesin/Kif4 group) (Eurofung); Comment: Berl Oakley: Identified as kinesin class 4 (Chromokinesin/Kif4 group) by Dr. Tetsuya Horio based on initial analysis by lab of Dr. R. Fischer. |
| AN6876.4 [Search PubMed] | oxidoreductase, FAD-binding, putative (AFU_orthologue; AFUA_2G14470) |
| AN6877.4 [Search PubMed] | conserved hypothetical protein |
| AN6878.4 [Search PubMed] | conserved hypothetical protein |
| AN11532.4 [Search PubMed] | hypothetical protein |
| AN6879.4 [Search PubMed] | MFS monocarboxylic acid transporter, putative (AFU_orthologue; AFUA_5G13230) |
| AN6880.4 [Search PubMed] | Inositol hexakisphosphate kinase (Eurofung); Comment: Pocsi, Miskei, Karanyi: Orthologue of C.albicans:ORF19.1007, S.cerevisiae:KCS1 involved in response to stress, product name: Inositol hexakisphosphate (IP6) kinase , EC number: 2.7.4.21 |
| AN6881.4 [Search PubMed] | conserved hypothetical protein |
| AN6882.4 [Search PubMed] | carboxyvinyl-carboxyphosphonate phosphorylmutase (AFU_orthologue; AFUA_2G00120) |
| AN6883.4 [Search PubMed] | MFS transporter, putative (AFU_orthologue; AFUA_2G00110) |
| AN6884.4 [Search PubMed] | Putative Zn(II)2Cys6 transcription factor (Eurofung); Comment: Manually curated A.F.J Ram and P.J. Punt A.F.J.Ram: similar to S. cerevisiae Aro80 activator of aromatic amino acid catabolism genes; Afu orthologue: AFUA_2G00100 |
| AN6885.4 [Search PubMed] | DUF614 domain protein (AFU_orthologue; AFUA_5G13250) |
| AN6886.4 [Search |